Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22200 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 202 / 4e-66 NHL1 NDR1/HIN1-like 1 (.1) AT3G52470 196 / 2e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35960 194 / 5e-63 NHL12 NDR1/HIN1-like 12 (.1) AT4G09590 184 / 1e-58 NHL22 NDR1/HIN1-like 22 (.1) AT5G06330 182 / 2e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35970 182 / 3e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G53730 138 / 6e-41 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G01410 112 / 2e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204200 [exp] 219 / 1e-72 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.016G071500 [exp] 216 / 2e-71 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.005G088000 [exp] 201 / 7e-66 AT3G44220 194 / 5e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G006000 [exp] 159 / 6e-49 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G002400 [exp] 153 / 6e-47 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 115 / 4e-32 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 112 / 8e-31 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G158900 [exp] 81 / 3e-18 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.004G197600 [exp] 73 / 2e-15 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021286 [exp] 214 / 6e-71 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 214 / 1e-70 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10043410 [exp] 194 / 1e-62 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034175 [exp] 182 / 6e-58 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10004202 [exp] 162 / 2e-50 AT3G11660 257 / 8e-88 NDR1/HIN1-like 1 (.1) Lus10029406 [exp] 158 / 1e-48 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1) Lus10013327 [exp] 138 / 2e-40 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1) Lus10032932 [exp] 129 / 2e-37 AT5G53730 211 / 4e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10000157 [exp] 117 / 6e-33 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10030193 [exp] 100 / 1e-25 AT4G01410 185 / 3e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.009G019600.1 pacid=42772173 polypeptide=Potri.009G019600.1.p locus=Potri.009G019600 ID=Potri.009G019600.1.v4.1 annot-version=v4.1 ATGTCCAAGGAAGTGGAAGACTGTGGCCACCACGACGCCGAGAACAAGCACCACCGCCACATATTCATAGGCATTCTTGCCGTCATCATCACCATTCTGG TGGTAATCTTCCTTGTATGGATAGTTTTACAGCCCCACAATCCTAGGTTCATCCTTCAAGACACTACCATCTATGGCTTGAATCTTTCAGACCCGAATTT CCTTTCTTCTAACATGCAAGTTACCATATCCACCAAAAACCCCAACGACAAGATTGGTATATACTATGAAAAGCTTGACATCTATGCTTCTTACCATAAC CAACAGATAACCTTGGCAACTGAACTGCCTCCGACCTACCAAGGCCACAATGACGTCTCAGTATGGTCTCCATTTCTGTATGGTGATGCCGTGCCTGTGT CTCCATATCTTGCTGTTTCAATTAACCAAGACGTGAATGCTGGGGTTCTGCTCTTTAATATCAAGATCAACGGGAAGCTAAAATGGAAGGTTGGCTCTTG GTTGTCTGGCAGGTACAGAATATTTGTGAATTGTCCAGCTTATATAACTCTCGGCAGCCGGAGTAATGGAATCAATGTCGGAACAGGGATCAAGTATCAG ATTGTACAGCATTGTCATGTGGATGTTTAA
AA sequence Show only first row Show all	>Potri.009G019600.1 pacid=42772173 polypeptide=Potri.009G019600.1.p locus=Potri.009G019600 ID=Potri.009G019600.1.v4.1 annot-version=v4.1 MSKEVEDCGHHDAENKHHRHIFIGILAVIITILVVIFLVWIVLQPHNPRFILQDTTIYGLNLSDPNFLSSNMQVTISTKNPNDKIGIYYEKLDIYASYHN QQITLATELPPTYQGHNDVSVWSPFLYGDAVPVSPYLAVSINQDVNAGVLLFNIKINGKLKWKVGSWLSGRYRIFVNCPAYITLGSRSNGINVGTGIKYQ IVQHCHVDV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G44220			Late embryogenesis abundant (L...		Potri.009G019600 [exp]	0	1
AT5G67230		IRX14-L, I14H	IRREGULAR XYLEM 14-LIKE, IRREG...		Potri.007G047500 [exp]	2.44	0.9519
AT2G37090		IRX9	IRREGULAR XYLEM 9, Nucleotide-...		Potri.006G131000 [exp]	4.69	0.9473
AT1G73140		TBL31	Plant protein of unknown funct...		Potri.001G376700 [exp]	5.47	0.9449
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Potri.015G129400 [exp]	6.00	0.9444	Pt-FLA14.7
AT1G09610			Protein of unknown function (D...		Potri.004G226800 [exp]	8.83	0.9400
AT5G03170		ATFLA11, FLA11,...	ARABIDOPSIS FASCICLIN-LIKE ARA...		Potri.006G129200 [exp]	9.79	0.9378	Pt-FLA11.1
AT3G16630		ATKINESIN-13A, ...	P-loop containing nucleoside t...		Potri.010G013500 [exp]	11.22	0.9373
AT2G34410		RWA3	REDUCED WALL ACETYLATION 3, O-...		Potri.011G079400 [exp]	12.64	0.9421
AT2G03200			Eukaryotic aspartyl protease f...		Potri.001G306200 [exp]	13.41	0.9321
AT2G28315			Nucleotide/sugar transporter f...		Potri.004G211900 [exp]	14.73	0.9378

Compare expression of checked genes

Potri.009G019600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.