Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44340 74 / 6e-17 VQ motif-containing protein (.1) AT3G58000 73 / 8e-17 VQ motif-containing protein (.1) AT3G60090 67 / 8e-15 VQ motif-containing protein (.1) AT2G42140 63 / 4e-13 VQ motif-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G230800 [exp] 191 / 1e-63 AT2G44340 79 / 6e-19 VQ motif-containing protein (.1) Potri.006G192100 [exp] 97 / 3e-26 AT2G42140 86 / 2e-21 VQ motif-containing protein (.1) Potri.016G046000 [exp] 94 / 6e-25 AT3G58000 120 / 1e-34 VQ motif-containing protein (.1) Potri.015G046600 [exp] 41 / 9e-05 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1) Potri.005G057800 [exp] 39 / 0.0006 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004172 [exp] 71 / 4e-15 AT2G42140 72 / 2e-15 VQ motif-containing protein (.1) Lus10021054 [exp] 63 / 2e-12 AT2G44340 76 / 7e-17 VQ motif-containing protein (.1) Lus10039494 [exp] 41 / 6e-05 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1) Lus10039493 [exp] 39 / 0.0003 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [poplar] [flax] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Potri.009G024200.1 pacid=42770915 polypeptide=Potri.009G024200.1.p locus=Potri.009G024200 ID=Potri.009G024200.1.v4.1 annot-version=v4.1 ATGGAAGGTATAGTTAGGCCGCACTCATATGACCCTAAATCATCACCTCCTTCTAAGCTAGGCATTCACAGAGATTCACATGTAATATCAAAGTTGATCA AGCCCAAAGTTCGCGTAATTCACATATTTGCACCAGAGATTATAAAGACTGATGTTGCAGATTTTAGAGAGCTTGTTCAGAGACTCACTGGCCAACCTTG TGAAAGTAAAGGCATGATCAAGAAGAAAGCAGGTAGCAGCAGTACTGCAGACAAGGGAAAGAAGAACACGGCAGGTTCCTCAATATGTGAGTCAAACAAG AAATCCATGCGTCAGTTGCCAGAGTTGGGGTTGCCTAGTTTGATTAGAGCAGAGAAACTTAAGGTGGAGGTGGAAGCAAATAAAATGTGGGGAGATTTGG ATGTGCAGCTGATTGATTTTGTCATATGA
AA sequence Show only first row Show all	>Potri.009G024200.1 pacid=42770915 polypeptide=Potri.009G024200.1.p locus=Potri.009G024200 ID=Potri.009G024200.1.v4.1 annot-version=v4.1 MEGIVRPHSYDPKSSPPSKLGIHRDSHVISKLIKPKVRVIHIFAPEIIKTDVADFRELVQRLTGQPCESKGMIKKKAGSSSTADKGKKNTAGSSICESNK KSMRQLPELGLPSLIRAEKLKVEVEANKMWGDLDVQLIDFVI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G58000			VQ motif-containing protein (....		Potri.009G024200 [exp]	0	1
AT2G44340			VQ motif-containing protein (....		Potri.001G230800 [exp]	1.41	0.9787
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.001G134450 [exp]	2.44	0.9668
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Potri.006G247700 [exp]	3.00	0.9651	Pt-WGA3.1
AT2G38300	GARP		myb-like HTH transcriptional r...		Potri.009G075100 [exp]	4.00	0.9601
AT5G61430	NAC	ANAC100, ATNAC5	NAC domain containing protein ...		Potri.015G020000 [exp]	8.66	0.9588	NAC021
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Potri.016G104500 [exp]	9.38	0.9424
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.003G099100 [exp]	9.79	0.9492
AT1G34300			lectin protein kinase family p...		Potri.016G102900 [exp]	10.95	0.9506
AT4G17800	AT-hook		Predicted AT-hook DNA-binding ...		Potri.001G142800 [exp]	11.74	0.9555
AT1G06150	bHLH	bHLH089, EMB144...	EMBRYO DEFECTIVE 1444, basic h...		Potri.006G090000 [exp]	12.32	0.9326

Compare expression of checked genes

Potri.009G024200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.