Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 62 / 2e-13 LTP6 lipid transfer protein 6 (.1.2) AT5G59320 59 / 2e-12 LTP3 lipid transfer protein 3 (.1) AT5G59310 59 / 3e-12 LTP4 lipid transfer protein 4 (.1) AT5G01870 51 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 49 / 2e-08 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51590 48 / 4e-08 LTP12 lipid transfer protein 12 (.1) AT2G38540 47 / 2e-07 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51600 46 / 3e-07 LTP5 lipid transfer protein 5 (.1) AT2G38530 43 / 3e-06 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G232900 [exp] 121 / 8e-37 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 119 / 4e-36 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 55 / 1e-10 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 55 / 1e-10 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135800 [exp] 54 / 3e-10 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 53 / 4e-10 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 52 / 2e-09 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.016G135500 [exp] 47 / 8e-08 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.011G021900 [exp] 47 / 1e-07 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025148 [exp] 61 / 7e-13 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025230 [exp] 60 / 4e-12 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10022745 [exp] 55 / 1e-10 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025151 [exp] 54 / 4e-10 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10014167 [exp] 53 / 7e-10 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10025231 [exp] 53 / 7e-10 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10026418 [exp] 51 / 3e-09 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10012384 [exp] 49 / 1e-08 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10022744 [exp] 47 / 2e-07 AT2G38540 86 / 1e-22 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Lus10028055 [exp] 46 / 3e-07 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF00234 [poplar] [flax] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Potri.009G025200.1 pacid=42771710 polypeptide=Potri.009G025200.1.p locus=Potri.009G025200 ID=Potri.009G025200.1.v4.1 annot-version=v4.1 ATGAACTCTTCAAGTGTAGTGGTGGCAGCAATGGCTGCACTAATGATGTTTCTTTTACTTGCCCCAACTTCTGATGCTGCGATTTCCTGCAGTGATGTGA TCAAGGACCTGAGGCCTTGTGTGAACTACCTTACGAGCGGCACTGGGAAACCACCTTCTGCATGCTGTGCAGGAGCCTCAGCTCTTCAATCTGCTGCATC AAGCACAGCTGATAAGAAGGCAGCTTGTGAGTGTATCAAATCAGCTTCAAAGTCATTAAATCCAAACCCCCAGTTAGCCCAGGCTCTTCCAGCTAACTGT GGAATCAGCTTGCCTTACACTATTTCTCCCAGTGTTGATTGTTCCAAGATTAGTTAG
AA sequence Show only first row Show all	>Potri.009G025200.1 pacid=42771710 polypeptide=Potri.009G025200.1.p locus=Potri.009G025200 ID=Potri.009G025200.1.v4.1 annot-version=v4.1 MNSSSVVVAAMAALMMFLLLAPTSDAAISCSDVIKDLRPCVNYLTSGTGKPPSACCAGASALQSAASSTADKKAACECIKSASKSLNPNPQLAQALPANC GISLPYTISPSVDCSKIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18370			Bifunctional inhibitor/lipid-t...		Potri.009G025200 [exp]	0	1
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Potri.010G237000 [exp]	1.73	0.9120
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Potri.002G156800 [exp]	2.82	0.9204
AT1G28440		HSL1	HAESA-like 1 (.1)		Potri.017G016600 [exp]	4.47	0.8843
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Potri.011G095100 [exp]	4.58	0.8919	ATGSL04.1
AT5G64667		IDL2	inflorescence deficient in abs...		Potri.005G189900 [exp]	4.69	0.8827
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.002G098300 [exp]	5.91	0.8994
AT1G29750		RKF1	receptor-like kinase in flower...		Potri.011G072300 [exp]	6.32	0.8906
AT3G14470			NB-ARC domain-containing disea...		Potri.015G121800 [exp]	7.34	0.8955	FRGA-A30.27
AT1G53270		ABCG10	ATP-binding cassette G10, ABC-...		Potri.011G112100 [exp]	8.48	0.8856	2
AT1G72210	bHLH	bHLH096	basic helix-loop-helix (bHLH) ...		Potri.005G071100 [exp]	8.94	0.8580

Compare expression of checked genes

Potri.009G025200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.