Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02570 188 / 1e-62 Histone superfamily protein (.1) AT2G28720 189 / 2e-62 Histone superfamily protein (.1) AT1G07790 186 / 1e-61 HTB1 Histone superfamily protein (.1) AT3G45980 185 / 4e-61 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1) AT3G46030 185 / 4e-61 HTB11 Histone superfamily protein (.1) AT5G59910 185 / 5e-61 HTB4 Histone superfamily protein (.1) AT3G53650 184 / 9e-61 Histone superfamily protein (.1) AT2G37470 181 / 1e-59 Histone superfamily protein (.1) AT5G22880 181 / 1e-59 HTB2, H2B HISTONE H2B, histone B2 (.1) AT3G09480 168 / 7e-55 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G091200 [exp] 191 / 2e-63 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.017G123700 [exp] 191 / 2e-63 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.010G231300 [exp] 189 / 6e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.008G030600 [exp] 189 / 9e-63 AT5G59910 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091400 [exp] 189 / 1e-62 AT2G28720 186 / 1e-61 Histone superfamily protein (.1) Potri.008G030400 [exp] 188 / 2e-62 AT5G59910 191 / 2e-63 Histone superfamily protein (.1) Potri.008G030500 [exp] 188 / 2e-62 AT5G59910 190 / 4e-63 Histone superfamily protein (.1) Potri.010G230701 [exp] 188 / 2e-62 AT5G59910 191 / 3e-63 Histone superfamily protein (.1) Potri.008G029900 [exp] 187 / 3e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040855 [exp] 189 / 8e-63 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1) Lus10017456 [exp] 188 / 2e-62 AT2G28720 226 / 1e-77 Histone superfamily protein (.1) Lus10005897 [exp] 188 / 4e-62 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1) Lus10005893 [exp] 187 / 4e-62 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1) Lus10023753 [exp] 186 / 7e-62 AT2G37470 203 / 7e-69 Histone superfamily protein (.1) Lus10016156 [exp] 186 / 1e-61 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1) Lus10037371 [exp] 185 / 3e-61 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1) Lus10041347 [exp] 185 / 5e-61 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10017292 [exp] 185 / 5e-61 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10013544 [exp] 184 / 7e-61 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Potri.009G028001.1 pacid=42771684 polypeptide=Potri.009G028001.1.p locus=Potri.009G028001 ID=Potri.009G028001.1.v4.1 annot-version=v4.1 ATGGCACCAAAAGCCGAGAAGAAGCCCGCCGAGAAGAAGCCTGCTGAGGAGAAGAAGACAGTGGCAGAGAAAGCCCCGGCAGAGAAGAAGCCGAAGGCAG GGAAGAAGCTTCCCAAAGAAGGAGGCGGCGCTGCTGCCGGAGACAAGAAGAAGAAGCGGGTGAAGAAGAGCACGGAGACATACAAGATTTACATCTTCAA GGTCCTAAAACAAGTTCATCCAGACATAGGGATTTCCAGCAAGGCTATGGGTATCATGAATTCCTTCATTAATGATATTTTCGAGAAGCTAGCACAGGAA TCCTCCAGGTTAGCCAGGTACAACAAAAAGCCCACAATTACCTCAAGGGAGATCCAGACGGCTGTGAGGTTGGTGTTGCCTGGAGAGTTGGCCAAGCATG CTGTTTCCGAGGGTACCAAGGCTGTTACTAAGTTTACAAGCTCTTGA
AA sequence Show only first row Show all	>Potri.009G028001.1 pacid=42771684 polypeptide=Potri.009G028001.1.p locus=Potri.009G028001 ID=Potri.009G028001.1.v4.1 annot-version=v4.1 MAPKAEKKPAEKKPAEEKKTVAEKAPAEKKPKAGKKLPKEGGGAAAGDKKKKRVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE SSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02570			Histone superfamily protein (....		Potri.009G028001 [exp]	0	1
AT3G19950			RING/U-box superfamily protein...		Potri.007G074014 [exp]	1.00	0.7762
AT3G29270			RING/U-box superfamily protein...		Potri.012G067200 [exp]	2.44	0.7128
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.018G069900 [exp]	3.74	0.7441
AT1G01230			ORMDL family protein (.1)		Potri.014G101000 [exp]	4.89	0.7236
AT1G25682			Family of unknown function (DU...		Potri.008G115700 [exp]	6.32	0.7046
AT3G54300		ATVAMP727	vesicle-associated membrane pr...		Potri.008G019400 [exp]	7.74	0.6870	VAMP727.1
AT1G66920			Protein kinase superfamily pro...		Potri.007G126200 [exp]	10.09	0.7281
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Potri.005G109900 [exp]	10.95	0.7142
AT1G09840		AtHIR1, ATSK41	hypersensitive induced reactio...		Potri.004G225700 [exp]	12.48	0.6752	ASK4.1
AT3G51100			unknown protein		Potri.005G117400 [exp]	12.48	0.6192

Compare expression of checked genes

Potri.009G028001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.