Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ADF6,Pt-ADF.6
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59890 256 / 1e-89 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 253 / 2e-88 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT5G59880 248 / 2e-86 ADF3 actin depolymerizing factor 3 (.1.2) AT3G46000 244 / 8e-85 ADF2 actin depolymerizing factor 2 (.1) AT1G01750 232 / 6e-80 ADF11 actin depolymerizing factor 11 (.1) AT4G00680 232 / 7e-80 ADF8 actin depolymerizing factor 8 (.1) AT4G25590 230 / 3e-79 ADF7 actin depolymerizing factor 7 (.1) AT5G52360 228 / 2e-78 ADF10 actin depolymerizing factor 10 (.1) AT2G31200 186 / 1e-61 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT4G34970 175 / 2e-57 ADF9 actin depolymerizing factor 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G236700 [exp] 283 / 3e-100 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 281 / 1e-99 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 270 / 7e-95 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.010G208500 [exp] 266 / 2e-93 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 260 / 3e-91 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.001G106200 [exp] 239 / 7e-83 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1) Potri.003G125500 [exp] 238 / 3e-82 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1) Potri.015G144500 [exp] 234 / 6e-81 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1) Potri.012G141600 [exp] 233 / 3e-80 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024418 [exp] 260 / 4e-91 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 255 / 3e-89 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 255 / 3e-89 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10023428 [exp] 262 / 1e-88 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10040307 [exp] 259 / 4e-88 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2) Lus10027474 [exp] 231 / 2e-79 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1) Lus10038859 [exp] 223 / 1e-76 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1) Lus10014977 [exp] 223 / 2e-76 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1) Lus10039229 [exp] 218 / 3e-74 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1) Lus10008489 [exp] 196 / 2e-65 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [poplar] [flax] ADF PF00241 [poplar] [flax] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Potri.009G028100.4 pacid=42772494 polypeptide=Potri.009G028100.4.p locus=Potri.009G028100 ID=Potri.009G028100.4.v4.1 annot-version=v4.1 ATGGCCAATGCAGCATCTGGTATGGCAGTGCATGATGACTGCAAGCTGAAGTTTTTGGAGCTCAAGGCTAAAAGAACTTACCGCTTCATAGTTTACAAGA TCGAAGAAGAGCAAAAGCAGGTTATTGTGGAAAAGCTTGGCGAGCCTGCCCAAAGCTATGAAGATTTTACTGCAAGCCTCCCTGCTGATGAGTGCCGCTA TGCTGTTTATGATTTTGATTTTGTGACTGAAGAGAATGTCCAAAAGAGCAGAATCTTCTTCATTGCATGGTGTCCCGACACATCAAGGGTGAGAAGCAAG ATGATTTATGCTAGTTCTAAGGACAGGTTCAAGAGAGAACTAGATGGTATTCAGGTAGAGTTGCAGGCAACCGATCCAACTGAAATGGGTCTCGATGTCA TTAAAAGCCGTGCCAGCTAA
AA sequence Show only first row Show all	>Potri.009G028100.4 pacid=42772494 polypeptide=Potri.009G028100.4.p locus=Potri.009G028100 ID=Potri.009G028100.4.v4.1 annot-version=v4.1 MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASLPADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSK MIYASSKDRFKRELDGIQVELQATDPTEMGLDVIKSRAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028100 [exp]	0	1	ADF6,Pt-ADF.6
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028200 [exp]	2.00	0.9296	Pt-ADF1.1
AT5G03300		ADK2	adenosine kinase 2 (.1)		Potri.010G224300 [exp]	3.16	0.9441	ADK2.2
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Potri.010G157600 [exp]	5.91	0.9168
AT4G31300		PBA1	N-terminal nucleophile aminohy...		Potri.006G077900 [exp]	6.32	0.9203	PBA1.2
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.013G005600 [exp]	8.66	0.8767
AT1G43890		ATRAB-C1, RAB18...	RAB GTPASE HOMOLOG 18-1, ARABI...		Potri.007G105500 [exp]	9.53	0.8703	Pt-RAB1.7
AT4G26570		ATCBL3	calcineurin B-like 3 (.1.2)		Potri.011G094900 [exp]	10.95	0.8954	CBL2.1
AT5G57815			Cytochrome c oxidase, subunit ...		Potri.018G099900 [exp]	11.74	0.8979
AT1G13440		GAPC2, GAPC-2	GLYCERALDEHYDE-3-PHOSPHATE DEH...		Potri.015G091400 [exp]	12.12	0.8868	Pt-GAPDH1.2
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Potri.010G141900 [exp]	12.84	0.9204	Pt-SAR1.2

Compare expression of checked genes

Potri.009G028100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.