Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59410 155 / 5e-50 Rab5-interacting family protein (.1) AT2G29020 122 / 2e-36 Rab5-interacting family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G241500 [exp] 168 / 6e-55 AT5G59410 188 / 6e-63 Rab5-interacting family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040798 [exp] 144 / 2e-45 AT5G59410 202 / 2e-68 Rab5-interacting family protein (.1) Lus10016530 [exp] 99 / 2e-27 AT5G59410 154 / 1e-49 Rab5-interacting family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07019 [poplar] [flax] Rab5ip Rab5-interacting protein (Rab5ip)
Representative CDS sequence Show only first row Show all	>Potri.009G032100.5 pacid=42772272 polypeptide=Potri.009G032100.5.p locus=Potri.009G032100 ID=Potri.009G032100.5.v4.1 annot-version=v4.1 ATGAAAGAAGGGAAATCTGCTGCTAAATTGAACAACAGTAATAATCAACAGCAACACCAGCATCAAAATGGGCACTTTTCTCCTTCCAAATTCGCCAAAT TGTTGGATCCTGAGGCCTCTTGGGACAAGGATCAATTGGGAGATGTGTTGCATTGGATTAGGCAAGTTGTTGCCCTCGTTTGCGGTATACTATGGGGTAC TATCCCTTTGGTCGGCGGTATTTGGATCGGCCTTTTTCTGTTGATTTCCTCTGGGATTATATATGGTTATTATGCAATGATATTAAAGATCGACGAAGAT GATTTTGGTGGTCATTCAGCTCTCCTCCAAGAAGGGCTCTTTGCTTCTATCACTCTATTCCTGCTATCGTGGATTCTAGTGTACAGCCTGGCCCACTTCT GA
AA sequence Show only first row Show all	>Potri.009G032100.5 pacid=42772272 polypeptide=Potri.009G032100.5.p locus=Potri.009G032100 ID=Potri.009G032100.5.v4.1 annot-version=v4.1 MKEGKSAAKLNNSNNQQQHQHQNGHFSPSKFAKLLDPEASWDKDQLGDVLHWIRQVVALVCGILWGTIPLVGGIWIGLFLLISSGIIYGYYAMILKIDED DFGGHSALLQEGLFASITLFLLSWILVYSLAHF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59410			Rab5-interacting family protei...		Potri.009G032100 [exp]	0	1
AT3G09800			SNARE-like superfamily protein...		Potri.001G197200 [exp]	2.00	0.9534
AT4G02580			NADH-ubiquinone oxidoreductase...		Potri.005G218000 [exp]	2.44	0.9405
AT4G00560			NAD(P)-binding Rossmann-fold s...		Potri.014G079700 [exp]	5.29	0.9393
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Potri.009G031200 [exp]	5.47	0.9403
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Potri.004G163000 [exp]	6.24	0.9270
AT4G17486			PPPDE putative thiol peptidase...		Potri.006G154400 [exp]	7.48	0.9315
AT5G05080		ATUBC22, UBC22	ubiquitin-conjugating enzyme 2...		Potri.006G026900 [exp]	7.93	0.9145
AT5G53650			unknown protein		Potri.015G006500 [exp]	8.48	0.9184
AT3G49720			unknown protein		Potri.009G082400 [exp]	9.48	0.9295
AT5G52180			unknown protein		Potri.015G140900 [exp]	11.40	0.9119

Compare expression of checked genes

Potri.009G032100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.