Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57290 106 / 7e-31 60S acidic ribosomal protein family (.1.2.3) AT4G25890 105 / 3e-30 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G010200 [exp] 133 / 3e-41 AT5G57290 102 / 4e-29 60S acidic ribosomal protein family (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012714 [exp] 94 / 1e-25 AT5G57290 102 / 4e-29 60S acidic ribosomal protein family (.1.2.3) Lus10010890 [exp] 92 / 4e-25 AT5G57290 102 / 4e-29 60S acidic ribosomal protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [poplar] [flax] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Potri.009G032600.1 pacid=42771554 polypeptide=Potri.009G032600.1.p locus=Potri.009G032600 ID=Potri.009G032600.1.v4.1 annot-version=v4.1 ATGGGAGTTTTCACCTTCGTTTGCAGGTGCTCCGGTAACGAGTGGAGTGCCAAGCAGATCGCCGAAGGCGATATTGAGGCCTCCGCTTCCTCCACCTTCG AGTTGCAAAGGAAACTTGTCCAATCTGCTCTCTCCGCTGATTCCTCCGGTGGCGTCCAGTCCTCTTTCTCTTACGTCACTCCTTCATCCGCCGTTTTCCA GGTGATCATTGGTGGCGGCTGTGGTGGAGCCTTCTTTGGCGGTGGTGGTGGAGGTGCAGCAGCGGCTCCAGCAGGAGGTGCAGCAGCTGCAGCTGAGGCA CCTGCTGCTGAGGAGAAGAAGAAGGAAGAGGAGCCAGAGAGTGATGATGATATGGGATTCTCTCTTTTTGATTAA
AA sequence Show only first row Show all	>Potri.009G032600.1 pacid=42771554 polypeptide=Potri.009G032600.1.p locus=Potri.009G032600 ID=Potri.009G032600.1.v4.1 annot-version=v4.1 MGVFTFVCRCSGNEWSAKQIAEGDIEASASSTFELQRKLVQSALSADSSGGVQSSFSYVTPSSAVFQVIIGGGCGGAFFGGGGGGAAAAPAGGAAAAAEA PAAEEKKKEEEPESDDDMGFSLFD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57290			60S acidic ribosomal protein f...		Potri.009G032600 [exp]	0	1
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.008G171200 [exp]	1.00	0.9683	RPL23.4
AT2G19740			Ribosomal protein L31e family ...		Potri.001G269600 [exp]	3.46	0.9580
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Potri.004G196500 [exp]	4.47	0.9558	Pt-RPL30.1
AT4G10450			Ribosomal protein L6 family (....		Potri.011G147700 [exp]	4.89	0.9579	Pt-RPL9.4
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Potri.002G140400 [exp]	5.00	0.9532	Pt-RPS11.5
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.015G007100 [exp]	6.32	0.9520	UBQ1.4
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.005G023500 [exp]	8.71	0.9380	Pt-RPL18.12
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.012G128300 [exp]	9.16	0.9527	Pt-RPS20.1
AT3G05560			Ribosomal L22e protein family ...		Potri.014G128800 [exp]	9.94	0.9508	RPL22.2
AT5G59850			Ribosomal protein S8 family pr...		Potri.003G114800 [exp]	11.48	0.9528	RPS15.1

Compare expression of checked genes

Potri.009G032600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.