Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59140 166 / 4e-55 BTB/POZ domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G175900 [exp] 42 / 6e-06 AT5G42190 245 / 2e-84 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.009G135800 [exp] 39 / 0.0002 AT1G20140 215 / 9e-73 SKP1-like 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040746 [exp] 193 / 5e-66 AT5G59140 167 / 2e-55 BTB/POZ domain-containing protein (.1) Lus10016485 [exp] 193 / 5e-66 AT5G59140 167 / 2e-55 BTB/POZ domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [poplar] [flax] POZ PF03931 [poplar] [flax] Skp1_POZ Skp1 family, tetramerisation domain
Representative CDS sequence Show only first row Show all	>Potri.009G037800.1 pacid=42772519 polypeptide=Potri.009G037800.1.p locus=Potri.009G037800 ID=Potri.009G037800.1.v4.1 annot-version=v4.1 ATGAGAAAGGAAGATACAGTGAAGCTGATAAGCGCGGAGGGTTTCGAGTTCGTGATCCACAAGGAAGCTGCTATGGTTTCACAAACAATCCGCAACATGC TCACTTCTCCAGGGAGTTTCGCGGAGACGGAGCATGGAGAAGTTACTTTTCCGGAGATAAGCACTACCATTCTAGAGAAGATCTGCCAGTACTTTTACTG GTCTCTTCAGTATGCCAATGGAAAGGAGACTGAATTCCCAATTGAACCTGAACTGACACTGGAGCTGATGATGGCTGCTAATTATCTCCACACTTAA
AA sequence Show only first row Show all	>Potri.009G037800.1 pacid=42772519 polypeptide=Potri.009G037800.1.p locus=Potri.009G037800 ID=Potri.009G037800.1.v4.1 annot-version=v4.1 MRKEDTVKLISAEGFEFVIHKEAAMVSQTIRNMLTSPGSFAETEHGEVTFPEISTTILEKICQYFYWSLQYANGKETEFPIEPELTLELMMAANYLHT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59140			BTB/POZ domain-containing prot...		Potri.009G037800 [exp]	0	1
AT2G39445			Phosphatidylinositol N-acetylg...		Potri.002G134800 [exp]	1.00	0.8122
AT5G01350			unknown protein		Potri.016G118800 [exp]	8.12	0.7089
AT4G35980			unknown protein		Potri.005G111900 [exp]	8.77	0.7065
AT3G07260	FHA		SMAD/FHA domain-containing pro...		Potri.002G245900 [exp]	10.58	0.6607
AT4G08230			glycine-rich protein (.1.2)		Potri.002G086600 [exp]	12.00	0.7300
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.010G063100 [exp]	12.64	0.7243
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.006G154000 [exp]	15.68	0.6173
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.014G153800 [exp]	16.49	0.6863
AT4G25225			unknown protein		Potri.001G124100 [exp]	16.73	0.6476
AT2G48150		ATGPX4	glutathione peroxidase 4 (.1)		Potri.014G138800 [exp]	18.16	0.6675	GPX4.1,PtrcGpx4

Compare expression of checked genes

Potri.009G037800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.