Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46870 326 / 2e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62350 155 / 4e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G09320 79 / 2e-16 VPS9B Vacuolar sorting protein 9 (VPS9) domain (.1) AT5G48730 61 / 2e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G39620 58 / 1e-09 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G05670 57 / 3e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) AT1G13040 56 / 8e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G61400 55 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G31850 55 / 2e-08 PGR3 proton gradient regulation 3 (.1) AT4G20090 54 / 4e-08 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G275000 [exp] 178 / 2e-55 AT1G62350 274 / 7e-94 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G134300 [exp] 95 / 4e-23 AT5G09320 114 / 1e-28 Vacuolar sorting protein 9 (VPS9) domain (.1) Potri.009G169600 [exp] 81 / 6e-18 AT5G09320 219 / 8e-67 Vacuolar sorting protein 9 (VPS9) domain (.1) Potri.006G242500 [exp] 64 / 2e-11 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074500 [exp] 64 / 3e-11 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271200 [exp] 63 / 3e-11 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242200 [exp] 63 / 3e-11 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271400 [exp] 62 / 5e-11 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.018G038300 [exp] 62 / 6e-11 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040756 [exp] 348 / 5e-122 AT3G46870 349 / 2e-122 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10016476 [exp] 345 / 1e-120 AT3G46870 346 / 3e-121 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000892 [exp] 186 / 2e-58 AT1G62350 318 / 3e-111 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036049 [exp] 184 / 2e-57 AT1G62350 316 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036633 [exp] 58 / 3e-10 AT4G39620 218 / 9e-69 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10011849 [exp] 60 / 4e-10 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035850 [exp] 60 / 5e-10 AT4G39620 579 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10043104 [exp] 58 / 2e-09 AT3G16890 720 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1) Lus10012328 [exp] 58 / 3e-09 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10006373 [exp] 58 / 3e-09 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.009G038200.1 pacid=42771565 polypeptide=Potri.009G038200.1.p locus=Potri.009G038200 ID=Potri.009G038200.1.v4.1 annot-version=v4.1 ATGTTAACTCGGGCTCTTTCGAGGTCAAAAATCCCAAATTTCAGTAGCATAATAGTTATCCTTCAAAACCTAACAACTAAACAATCCATTATAGATCAAA CGCAATTGCCACTCTCAAAAGCCTCAAATATCCAATCTTTTTTAGTTCCTGCTGGGTTGCGGCAATATCACGATGGAAGGCCAAGAGGGCCACTCTGGAG AGGCAAGAAGCTGATTGGAAAAGAAGCCCTTTTTGTAATACTTGGATTGAAGAGGTTTAAAAATGATGATGATGAGAAGCTTGACAGATTTATTAAAACC CACGTTTTCAGACTTTTGAAACTGGACATGATTGCTGTTTTGTCTGAGCTTGAGCGACAAGAGGAGGTTTCTTTGGCTGTTAAGATTTTTAGAGTGATTC AAAAGCAAGATTGGTATAAGCCGGATGTGTATCTCTATAAGGATTTGATTATGGCATTACTGAAAACTGGAAAAATGGAAGAGGCAATGAAGTTATGGGA AGATATGAGAAATGAGGATTTGTTCCCGGATTCCCAAATGTATACCGAAGCCATTAGAGGCTACTTGAGGGATGGGTCTCCTGCTGATGCAATGAACATA TATGAAGACATGAAGAAGTCACCAGATCCTCCCGAGGAGTTGCCGTTTAGGATTCTGTTGAAGGGGCTTTTACCACACCCGCTTTTGAGGAATAGAGTAA AGCAAGATTACGAGGAGCTATTTCCAGAAAAACATGTTTATGACCCTCCAGAAGAGATATTCGGAATTCTCTGA
AA sequence Show only first row Show all	>Potri.009G038200.1 pacid=42771565 polypeptide=Potri.009G038200.1.p locus=Potri.009G038200 ID=Potri.009G038200.1.v4.1 annot-version=v4.1 MLTRALSRSKIPNFSSIIVILQNLTTKQSIIDQTQLPLSKASNIQSFLVPAGLRQYHDGRPRGPLWRGKKLIGKEALFVILGLKRFKNDDDEKLDRFIKT HVFRLLKLDMIAVLSELERQEEVSLAVKIFRVIQKQDWYKPDVYLYKDLIMALLKTGKMEEAMKLWEDMRNEDLFPDSQMYTEAIRGYLRDGSPADAMNI YEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDYEELFPEKHVYDPPEEIFGIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G46870			Pentatricopeptide repeat (PPR)...		Potri.009G038200 [exp]	0	1
AT1G14990			unknown protein		Potri.008G129900 [exp]	2.23	0.8905
AT5G58230		MSI1, MEE70, AT...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.002G216200 [exp]	4.00	0.8718
AT1G16790			ribosomal protein-related (.1)		Potri.010G254100 [exp]	5.65	0.8747
AT4G31980			unknown protein		Potri.003G209500 [exp]	6.70	0.8725
AT4G35220			Cyclase family protein (.1)		Potri.001G301501 [exp]	11.66	0.8679
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Potri.008G060000 [exp]	11.83	0.8199	Pt-EIF3.1
AT1G08610			Pentatricopeptide repeat (PPR)...		Potri.019G019200 [exp]	14.00	0.8689
AT5G41650			Lactoylglutathione lyase / gly...		Potri.003G135100 [exp]	17.08	0.8073
AT3G52230			unknown protein		Potri.010G233400 [exp]	19.36	0.8437
AT5G06430			Thioredoxin superfamily protei...		Potri.014G035300 [exp]	19.44	0.7871

Compare expression of checked genes

Potri.009G038200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.