Plant FIBer expression Database

COPT1.2 (Potri.009G038800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol COPT1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59030 148 / 3e-46 COPT1 copper transporter 1 (.1)
AT3G46900 134 / 2e-40 COPT2 copper transporter 2 (.1)
AT2G26975 130 / 2e-39 Ctr copper transporter family (.1)
AT5G59040 127 / 7e-38 COPT3 copper transporter 3 (.1)
AT2G37925 105 / 2e-29 COPT4 copper transporter 4 (.1)
AT5G20650 56 / 3e-10 COPT5 copper transporter 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G246000
[exp]
212 / 2e-71 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.009G038700
[exp]
182 / 7e-60 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093300
[exp]
130 / 4e-39 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.006G093200
[exp]
98 / 2e-26 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.006G140700
[exp]
57 / 5e-11 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
Potri.006G219200
[exp]
52 / 9e-09 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016464
[exp]
154 / 2e-48 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10040726
[exp]
146 / 2e-45 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10021108
[exp]
135 / 5e-41 AT2G37925 120 / 2e-35 copper transporter 4 (.1)
Lus10017204
[exp]
106 / 3e-30 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Lus10016462
[exp]
84 / 4e-22 AT5G59030 76 / 3e-19 copper transporter 1 (.1)
Lus10021107
[exp]
86 / 1e-21 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017205
[exp]
83 / 1e-20 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Lus10016463
[exp]
76 / 2e-18 AT2G26975 92 / 5e-25 Ctr copper transporter family (.1)
Lus10023045
[exp]
74 / 5e-17 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1)
Lus10032428
[exp]
69 / 2e-15 AT2G26975 87 / 1e-22 Ctr copper transporter family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Potri.009G038800.1 pacid=42771805 polypeptide=Potri.009G038800.1.p locus=Potri.009G038800 ID=Potri.009G038800.1.v4.1 annot-version=v4.1
ATGGAACATGGTCATGATATGCCGGGCATGGGGGGCATGGGGGGCATGGCTCCACCGCCGCCCATGAACATGGCAGGAACGATGCAACACCACGAGATGA
TGATGATGCACATGACCTTCTTTTGGGGGAAGAGTACTGAAATTCTCTTCTCTGGCTGGCCTGGAAGCTCTGATAAGAGACCACACATGTATTTTGTGGC
TTTGCTGTTTGTTTTTGTGCTTTCCATTCTTGTCGAGTGGCTATCCCATTGCCAATTGATGAAGCCTGGCTCGAACCATGTGGCGGCTGGTCTAGTCCAG
ACTCTACTGCACGCTTTGCGGGTTGGTTTAGCCTATATGGTCATGTTGGCTATCATGTCTTTCAATGGCGGCGTGTTCCTGGCTGCTGTGGCTGGGCATA
CTCTGGGGTTCCTGTTTTTTGGCAGTAGGGTTTTTAAGAGAACCCAAAATCCTGCTAAAACCTCTGATCTTCCTCCATCGAGTTGTTGA
AA sequence
>Potri.009G038800.1 pacid=42771805 polypeptide=Potri.009G038800.1.p locus=Potri.009G038800 ID=Potri.009G038800.1.v4.1 annot-version=v4.1
MEHGHDMPGMGGMGGMAPPPPMNMAGTMQHHEMMMMHMTFFWGKSTEILFSGWPGSSDKRPHMYFVALLFVFVLSILVEWLSHCQLMKPGSNHVAAGLVQ
TLLHALRVGLAYMVMLAIMSFNGGVFLAAVAGHTLGFLFFGSRVFKRTQNPAKTSDLPPSSC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G59030 COPT1 copper transporter 1 (.1) Potri.009G038800
[exp]
0 1 COPT1.2
AT5G43260 chaperone protein dnaJ-related... Potri.003G171800
[exp]
3.00 0.9491
AT1G52827 ATCDT1 cadmium tolerance 1 (.1) Potri.001G177366
[exp]
5.74 0.9462
AT5G61820 unknown protein Potri.015G108600
[exp]
6.63 0.9353
AT5G03555 permease, cytosine/purines, ur... Potri.006G119500
[exp]
6.78 0.9472
AT3G53810 Concanavalin A-like lectin pro... Potri.006G088801
[exp]
7.48 0.9374
AT3G17650 YSL5, PDE321 pigment defective 321, YELLOW ... Potri.017G151600
[exp]
9.74 0.9292
AT4G29070 Phospholipase A2 family protei... Potri.001G275300
[exp]
10.48 0.9403
AT2G24390 AIG2-like (avirulence induced ... Potri.018G003000
[exp]
10.58 0.9328
AT1G06110 SKIP16 SKP1/ASK-interacting protein 1... Potri.015G078100
[exp]
12.96 0.9430
AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 ... Potri.007G117200
[exp]
17.49 0.9370 Pt-ZOG1.9

Potri.009G038800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.