Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46660 100 / 3e-25 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT5G59580 100 / 3e-25 UGT76E1 UDP-glucosyl transferase 76E1 (.1) AT5G38010 97 / 2e-24 UDP-Glycosyltransferase superfamily protein (.1) AT5G38040 97 / 4e-24 UDP-Glycosyltransferase superfamily protein (.1) AT3G11340 97 / 4e-24 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) AT3G46720 96 / 9e-24 UDP-Glycosyltransferase superfamily protein (.1) AT3G46670 96 / 1e-23 UGT76E11 UDP-glucosyl transferase 76E11 (.1) AT3G46700 96 / 1e-23 UDP-Glycosyltransferase superfamily protein (.1) AT5G59590 93 / 8e-23 UGT76E2 UDP-glucosyl transferase 76E2 (.1) AT3G46650 92 / 3e-22 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G039100 [exp] 107 / 1e-27 AT3G09360 412 / 7e-134 Cyclin/Brf1-like TBP-binding protein (.1) Potri.001G245900 [exp] 103 / 1e-26 AT3G46660 452 / 7e-157 UDP-glucosyl transferase 76E12 (.1) Potri.010G195500 [exp] 98 / 1e-24 AT3G11340 483 / 3e-169 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195300 [exp] 96 / 9e-24 AT3G11340 485 / 6e-170 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195600 [exp] 95 / 2e-23 AT3G55700 515 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.006G039300 [exp] 83 / 4e-19 AT5G59590 347 / 2e-115 UDP-glucosyl transferase 76E2 (.1) Potri.006G022500 [exp] 82 / 8e-19 AT1G22400 514 / 3e-180 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.006G022600 [exp] 82 / 9e-19 AT1G22400 515 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.006G023700 [exp] 82 / 1e-18 AT1G22370 476 / 2e-165 UDP-glucosyl transferase 85A5 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004671 [exp] 97 / 4e-24 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10004672 [exp] 93 / 1e-22 AT3G11340 417 / 1e-142 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10037268 [exp] 93 / 1e-22 AT3G11340 447 / 1e-154 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040246 [exp] 91 / 4e-22 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10004673 [exp] 86 / 1e-21 AT3G11340 236 / 1e-76 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040725 [exp] 89 / 2e-21 AT5G59590 408 / 9e-140 UDP-glucosyl transferase 76E2 (.1) Lus10016460 [exp] 86 / 4e-20 AT5G59590 400 / 2e-136 UDP-glucosyl transferase 76E2 (.1) Lus10016461 [exp] 85 / 9e-20 AT3G11340 381 / 3e-129 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10016459 [exp] 84 / 1e-19 AT5G59590 357 / 3e-119 UDP-glucosyl transferase 76E2 (.1) Lus10013921 [exp] 83 / 1e-19 AT1G22380 320 / 3e-107 UDP-glucosyl transferase 85A3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF00201 [poplar] [flax] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Potri.009G038950.1 pacid=42771625 polypeptide=Potri.009G038950.1.p locus=Potri.009G038950 ID=Potri.009G038950.1.v4.1 annot-version=v4.1 ATGGGCTCTCCAGAAGGAAGTATCAGGACATGTTGCCGTGCGCGAGGATTTTGGGCCGACTGTGGATGGAATTCAACACTGGAGCGTGTGTGTGAAGGAA TTCTAATGCCATGCAGGCCATTTTTTGGAGACCAACGTTTGAATATTAAGTATGTTTGTCGTCTATGGAAGGTAGACCTTGAATTAGACAACGAATTTGA GAGAGGAAAAATACACGAAGCTGTAAGAAAATTAATGGGGGATAAAGACGGGGAGAAGGTGAGACAAAGAGCAGTAAAATTTAAGGAGAAGGCGAAGATT GTTTGGTGGAGGACGGCTCTTCCTTCTTCTCATCAACAATTTAATGGAACATATCTTATCATGCTGACAACTAGAAGATGGGATCACTCTTCGCAAATGC CAAAAGCTATTCCATTGGCAATAATAAGACTATCCATATTCAGATGGTTGTACAGCAAAGCTTAG
AA sequence Show only first row Show all	>Potri.009G038950.1 pacid=42771625 polypeptide=Potri.009G038950.1.p locus=Potri.009G038950 ID=Potri.009G038950.1.v4.1 annot-version=v4.1 MGSPEGSIRTCCRARGFWADCGWNSTLERVCEGILMPCRPFFGDQRLNIKYVCRLWKVDLELDNEFERGKIHEAVRKLMGDKDGEKVRQRAVKFKEKAKI VWWRTALPSSHQQFNGTYLIMLTTRRWDHSSQMPKAIPLAIIRLSIFRWLYSKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G46660		UGT76E12	UDP-glucosyl transferase 76E12...		Potri.009G038950 [exp]	0	1
AT1G21326			VQ motif-containing protein (....		Potri.005G189300 [exp]	5.19	0.9096
AT2G42140			VQ motif-containing protein (....		Potri.006G192100 [exp]	7.54	0.9023
AT3G13600			calmodulin-binding family prot...		Potri.001G006200 [exp]	18.73	0.8668
AT1G22170			Phosphoglycerate mutase family...		Potri.005G168000 [exp]	19.41	0.8663
AT2G35910			RING/U-box superfamily protein...		Potri.010G243400 [exp]	24.69	0.8884
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.005G032700 [exp]	26.32	0.8813
AT3G12580		ATHSP70, HSP70	ARABIDOPSIS HEAT SHOCK PROTEIN...		Potri.008G054900 [exp]	26.60	0.8839	HSP70.7
AT5G58240		FHIT	FRAGILE HISTIDINE TRIAD (.1.2)		Potri.013G161100 [exp]	28.61	0.8829
AT5G09220		AAP2	amino acid permease 2 (.1)		Potri.005G068900 [exp]	30.00	0.8661	AAP1.1
AT2G23620		ATMES1	ARABIDOPSIS THALIANA METHYL ES...		Potri.007G037300 [exp]	34.11	0.8801

Compare expression of checked genes

Potri.009G038950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.