Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	TIM10.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29530 141 / 9e-46 TIM10 Tim10/DDP family zinc finger protein (.1.2.3) AT3G46560 36 / 0.0004 TIM9, EMB2474 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) AT1G61570 36 / 0.0005 TIM13 translocase of the inner mitochondrial membrane 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G246500 [exp] 178 / 2e-60 AT2G29530 139 / 6e-45 Tim10/DDP family zinc finger protein (.1.2.3) Potri.012G039100 [exp] 37 / 0.0002 AT3G46560 154 / 1e-50 embryo defective 2474, Tim10/DDP family zinc finger protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016453 [exp] 158 / 2e-52 AT2G29530 145 / 2e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10040718 [exp] 154 / 9e-51 AT2G29530 146 / 1e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10017463 [exp] 41 / 7e-06 AT3G46560 156 / 2e-51 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10037964 [exp] 37 / 0.0003 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10038695 [exp] 37 / 0.0003 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [poplar] [flax] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Potri.009G039600.1 pacid=42770879 polypeptide=Potri.009G039600.1.p locus=Potri.009G039600 ID=Potri.009G039600.1.v4.1 annot-version=v4.1 ATGGCTGCCAATAACGTTGGTCTACCAGCTGGTGTCTCCAAAGAACAGGCCTATGGCATGGCTGAGACCGAGATGGAATACAGAGTCGAGCTGTTTAACA GGCTTCTCAATACATGTTTCAACAAGTGCATTGACAAAAGGCACAAGGAGGCTGAGTTAAACATGGGTGAAAATAGTTGTGTTGACAGATGTGTTTCGAA ATACTGGGCAGTGAATGGTATTATCGGCCAGATGCTCAGTGCTGGTCAACGTCCAATGTGA
AA sequence Show only first row Show all	>Potri.009G039600.1 pacid=42770879 polypeptide=Potri.009G039600.1.p locus=Potri.009G039600 ID=Potri.009G039600.1.v4.1 annot-version=v4.1 MAANNVGLPAGVSKEQAYGMAETEMEYRVELFNRLLNTCFNKCIDKRHKEAELNMGENSCVDRCVSKYWAVNGIIGQMLSAGQRPM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Potri.009G039600 [exp]	0	1	TIM10.1
AT5G10780			unknown protein		Potri.006G266300 [exp]	2.00	0.8111
AT2G44050		COS1	coronatine insensitive1 suppre...		Potri.017G001800 [exp]	2.44	0.8163	Pt-COS1.2
AT4G29480			Mitochondrial ATP synthase sub...		Potri.006G231900 [exp]	6.48	0.7859
AT2G18110			Translation elongation factor...		Potri.012G096400 [exp]	12.68	0.7718	Pt-EEF1.2
AT2G31140			Peptidase S24/S26A/S26B/S26C f...		Potri.005G225100 [exp]	13.22	0.7121
AT1G22520			Domain of unknown function (DU...		Potri.013G105766 [exp]	13.74	0.7618
AT5G40810			Cytochrome C1 family (.1.2)		Potri.009G165000 [exp]	13.85	0.7872
AT5G60390			GTP binding Elongation factor ...		Potri.010G219500 [exp]	14.14	0.7565
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Potri.008G171100 [exp]	16.12	0.6921	Pt-EIF(ISO)4E.2
AT3G26340			N-terminal nucleophile aminohy...		Potri.008G177000 [exp]	17.43	0.7670	Pt-PBE1.2

Compare expression of checked genes

Potri.009G039600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.