ATPH1.1 (Potri.009G044500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol ATPH1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29700 234 / 9e-81 ATPH1 pleckstrin homologue 1 (.1)
AT5G05710 221 / 1e-75 Pleckstrin homology (PH) domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G250400 281 / 2e-99 AT2G29700 229 / 1e-78 pleckstrin homologue 1 (.1)
Potri.008G066700 216 / 3e-73 AT5G05710 239 / 2e-82 Pleckstrin homology (PH) domain superfamily protein (.1)
Potri.010G190500 209 / 2e-70 AT5G05710 232 / 1e-79 Pleckstrin homology (PH) domain superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040681 258 / 3e-90 AT2G29700 230 / 3e-79 pleckstrin homologue 1 (.1)
Lus10018222 208 / 3e-69 AT2G29700 190 / 1e-61 pleckstrin homologue 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0266 PH PF00169 PH PH domain
Representative CDS sequence
>Potri.009G044500.1 pacid=42771705 polypeptide=Potri.009G044500.1.p locus=Potri.009G044500 ID=Potri.009G044500.1.v4.1 annot-version=v4.1
ATGGAGTCCATCTTGCGATCCTTAACGGGTCAAGACCCGAACCCGGATGATTACAGAAACATCGAGTTCTGGTCAGACCCGGAACGGTCCGGTTGGCTAA
CAAAGCAAGGAGACTACATAAAAACCTGGCGACGTCGCTGGTTCGTTCTCAAACAAGGGAAACTTCTCTGGTTCAAGGAGAGAAGCGTGACGCGAGGGTC
AATTCCACGCGGGGTGATCCCAGTGGGCAAGTGCTTGACCGTGAAAGGTGCAGAAGATGTGCTTAACAAACCTTATGCTTTTGAGCTTTCGACGAGCCAA
GAAACAATGTATTTTATAGCAGATTCGGAGAAAGAGAAAGAGGAGTGGATCAATTCGATTGGGAGGTCAATTGTTCAACACTCACGGTCTGTTACTGATT
CTGAGATTGTTGATTATGACAGCACTCGTTGA
AA sequence
>Potri.009G044500.1 pacid=42771705 polypeptide=Potri.009G044500.1.p locus=Potri.009G044500 ID=Potri.009G044500.1.v4.1 annot-version=v4.1
MESILRSLTGQDPNPDDYRNIEFWSDPERSGWLTKQGDYIKTWRRRWFVLKQGKLLWFKERSVTRGSIPRGVIPVGKCLTVKGAEDVLNKPYAFELSTSQ
ETMYFIADSEKEKEEWINSIGRSIVQHSRSVTDSEIVDYDSTR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G29700 ATPH1 pleckstrin homologue 1 (.1) Potri.009G044500 0 1 ATPH1.1
AT3G11530 Vacuolar protein sorting 55 (V... Potri.006G209100 1.73 0.7857
AT4G08230 glycine-rich protein (.1.2) Potri.002G086600 2.44 0.8024
AT3G23325 Splicing factor 3B subunit 5/R... Potri.008G168000 4.00 0.7857
AT4G35980 unknown protein Potri.005G111900 6.00 0.7509
AT5G05800 unknown protein Potri.004G135901 7.48 0.7359
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.014G160900 10.39 0.7778
AT1G54210 ATATG12, APG12,... AUTOPHAGY 12 A, AUTOPHAGY 12, ... Potri.001G169700 13.00 0.7402
AT5G42190 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubi... Potri.002G018700 14.69 0.7732 Pt-SKP1.2
AT2G39445 Phosphatidylinositol N-acetylg... Potri.002G134800 15.09 0.7169
AT4G08230 glycine-rich protein (.1.2) Potri.005G174700 19.07 0.7745

Potri.009G044500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.