Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29940 171 / 2e-50 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) AT2G26910 132 / 9e-37 PEC1, ABCG32, PDR4, ATPDR4 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) AT1G15210 131 / 1e-36 ABCG35, PDR7, ATPDR7 ATP-binding cassette G35, pleiotropic drug resistance 7 (.1) AT1G59870 130 / 3e-36 ATABCG36, ABCG36, PEN3, PDR8, ATPDR8 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) AT3G16340 130 / 3e-36 ABCG29, ATPDR1, PDR1, AtABCG29 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) AT1G66950 122 / 2e-33 ABCG39, PDR11, ATPDR11 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) AT1G15520 120 / 1e-32 ATABCG40, ABCG40, PDR12, ATPDR12 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) AT2G36380 114 / 2e-30 ABCG34, PDR6, ATPDR6 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) AT2G37280 103 / 1e-26 ABCG33, PDR5, ATPDR5 ATP-binding cassette G33, pleiotropic drug resistance 5 (.1) AT3G30842 101 / 4e-26 ABCG38, PDR10, ATPDR10 ATP-binding cassette G38, pleiotropic drug resistance 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G251100 [exp] 184 / 4e-55 AT2G29940 2081 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Potri.001G189500 [exp] 139 / 3e-39 AT1G59870 2113 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Potri.001G048700 [exp] 135 / 5e-38 AT1G15520 2000 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.018G032900 [exp] 134 / 2e-37 AT1G15520 2041 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G049600 [exp] 133 / 2e-37 AT3G16340 2065 / 0.0 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) Potri.018G074500 [exp] 131 / 1e-36 AT2G26910 2293 / 0.0 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) Potri.006G248500 [exp] 130 / 2e-36 AT1G15520 2050 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G183200 [exp] 130 / 3e-36 AT1G15520 2031 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G049000 [exp] 129 / 7e-36 AT1G15520 1847 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020550 [exp] 168 / 1e-49 AT2G29940 1962 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Lus10018230 [exp] 164 / 5e-48 AT2G29940 2141 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Lus10014150 [exp] 137 / 1e-38 AT3G16340 2221 / 0.0 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) Lus10037562 [exp] 137 / 2e-38 AT1G59870 2178 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Lus10025824 [exp] 135 / 4e-38 AT1G59870 2220 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Lus10019453 [exp] 132 / 5e-37 AT2G26910 2354 / 0.0 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) Lus10024060 [exp] 131 / 1e-36 AT1G15520 2115 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10041668 [exp] 131 / 1e-36 AT1G15520 2128 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10024061 [exp] 131 / 1e-36 AT1G15520 2139 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10041684 [exp] 130 / 1e-36 AT1G15520 899 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0181 [poplar] [flax] ABC-2 PF01061 [poplar] [flax] ABC2_membrane ABC-2 type transporter
Representative CDS sequence Show only first row Show all	>Potri.009G045601.1 pacid=42772055 polypeptide=Potri.009G045601.1.p locus=Potri.009G045601 ID=Potri.009G045601.1.v4.1 annot-version=v4.1 ATGCTCAAGGCTCGCAGGCTCAGTTTTTTTATTTGCCTTTGGAAACAAAATCTTGTATACTGGAGAAGTCCACAATACAATGGTGTGAGGCTATTTTTTA CTGTATTAGCTGCATTTCTATTAGGCTCGGTATTCTGGGATATTGGTTCAGAAAGGGACTCAGCTCAAGCTTTGTTTCTGGTTATGGGAGCACTATGTTC TTCATGCATGTTTCTCGGGGTCAGTAATGCTTCCACAGTACAGCCAATAGTTTCAATTGAGAGAACTGTTTTCTACAGAGAGAAAGCAGCCGGAATGTAC TCTCCATTATCCTATGCAATGGCCCAGGTGACTGTCACTGTGCTGAAGAAATAG
AA sequence Show only first row Show all	>Potri.009G045601.1 pacid=42772055 polypeptide=Potri.009G045601.1.p locus=Potri.009G045601 ID=Potri.009G045601.1.v4.1 annot-version=v4.1 MLKARRLSFFICLWKQNLVYWRSPQYNGVRLFFTVLAAFLLGSVFWDIGSERDSAQALFLVMGALCSSCMFLGVSNASTVQPIVSIERTVFYREKAAGMY SPLSYAMAQVTVTVLKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Potri.009G045601 [exp]	0	1
AT3G48940			Remorin family protein (.1)		Potri.012G140900 [exp]	2.23	0.9633
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015500 [exp]	2.82	0.9527
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015601 [exp]	4.24	0.9428
AT1G52140			unknown protein		Potri.018G046500 [exp]	6.48	0.9045
AT5G21990		OEP61, TPR7	tetratricopeptide repeat 7, ou...		Potri.005G156250 [exp]	6.92	0.8981
					Potri.016G031232 [exp]	7.93	0.9333
					Potri.018G011950 [exp]	8.06	0.9361
AT1G26230		Cpn60beta4	chaperonin-60beta4, TCP-1/cpn6...		Potri.010G135100 [exp]	9.16	0.9336
					Potri.016G031166 [exp]	10.39	0.9290
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Potri.014G159800 [exp]	13.96	0.9188

Compare expression of checked genes

Potri.009G045601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.