Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58740 97 / 3e-27 HSP20-like chaperones superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G251204 [exp] 113 / 1e-33 AT5G58740 298 / 1e-105 HSP20-like chaperones superfamily protein (.1) Potri.001G132500 [exp] 40 / 5e-05 AT5G53400 225 / 1e-73 BOBBER1, HSP20-like chaperones superfamily protein (.1) Potri.003G100900 [exp] 37 / 0.0005 AT5G53400 232 / 2e-75 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040670 [exp] 82 / 2e-21 AT5G58740 216 / 2e-73 HSP20-like chaperones superfamily protein (.1) Lus10018234 [exp] 72 / 2e-17 AT5G58740 266 / 8e-93 HSP20-like chaperones superfamily protein (.1) Lus10018250 [exp] 39 / 0.0002 AT5G53400 213 / 4e-69 BOBBER1, HSP20-like chaperones superfamily protein (.1) Lus10040656 [exp] 39 / 0.0002 AT5G53400 216 / 3e-70 BOBBER1, HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [poplar] [flax] HSP20 PF04969 [poplar] [flax] CS CS domain
Representative CDS sequence Show only first row Show all	>Potri.009G046000.1 pacid=42771929 polypeptide=Potri.009G046000.1.p locus=Potri.009G046000 ID=Potri.009G046000.1.v4.1 annot-version=v4.1 ATGGCTGAGAAATTGGCTCCAGAGAAGCGCCACAGCTTCGTCCGTGAAGATAAAACTGTATTTGAGTGGGATCAAACCCTCGAAGAGGTGAATATTTACA TAAATTTACCGCCAAATGTTCACTCTAAGCAGTTTTACTGCAAGATTCAGTCCAAACATGCCTTCATTAGCATGTCAAGAAATCCTGACGATCTTCTGGT AAACGGCACGAGTATTTGTGTTTCTCCCTTCAGTCCTGAGACTTTAATTAGCCTACCAGTCTTGTAG
AA sequence Show only first row Show all	>Potri.009G046000.1 pacid=42771929 polypeptide=Potri.009G046000.1.p locus=Potri.009G046000 ID=Potri.009G046000.1.v4.1 annot-version=v4.1 MAEKLAPEKRHSFVREDKTVFEWDQTLEEVNIYINLPPNVHSKQFYCKIQSKHAFISMSRNPDDLLVNGTSICVSPFSPETLISLPVL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G58740			HSP20-like chaperones superfam...		Potri.009G046000 [exp]	0	1
AT3G58040		SINAT2	seven in absentia of Arabidops...		Potri.001G010500 [exp]	13.11	0.7215
AT5G64430			Octicosapeptide/Phox/Bem1p fam...		Potri.009G080200 [exp]	14.42	0.7220
AT1G24440			RING/U-box superfamily protein...		Potri.010G052700 [exp]	24.24	0.7007
AT1G24440			RING/U-box superfamily protein...		Potri.008G181300 [exp]	25.92	0.6989
AT4G28240			Wound-responsive family protei...		Potri.019G116300 [exp]	41.12	0.6689
AT4G22350			Ubiquitin C-terminal hydrolase...		Potri.006G010100 [exp]	41.42	0.6588
AT2G44130			Galactose oxidase/kelch repeat...		Potri.003G218400 [exp]	45.46	0.6790
AT1G14670			Endomembrane protein 70 protei...		Potri.012G042300 [exp]	71.06	0.6366
AT1G45249	bZIP	AtABF2, ATAREB1...	ABSCISIC ACID RESPONSIVE ELEME...		Potri.014G028200 [exp]	83.18	0.6492	Pt-ABF2.1
AT4G03030			Galactose oxidase/kelch repeat...		Potri.002G041900 [exp]	93.27	0.6539

Compare expression of checked genes

Potri.009G046000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.