Potri.009G047200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47295 38 / 4e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.009G047200.1 pacid=42771496 polypeptide=Potri.009G047200.1.p locus=Potri.009G047200 ID=Potri.009G047200.1.v4.1 annot-version=v4.1
ATGAGGTTTGGAATTTGCCACTTCGCTTACGTGTTCTTTGCCCTAATGATGATGATGAGCATTTCTCCAAACACCATTCGACTCTCAGGTGGGAACGAAA
ATAAGTTGGCTGTGGCTAGAAGGCTAGTAAAGGTGGGAATCAATGATTATGAAGAGCCAGGGGCAAGCGTTAAGCATCGTCCTGCACCCCCTGGTGATGA
GTTTGGTGATAAAGCTCAAGATCATCAATAA
AA sequence
>Potri.009G047200.1 pacid=42771496 polypeptide=Potri.009G047200.1.p locus=Potri.009G047200 ID=Potri.009G047200.1.v4.1 annot-version=v4.1
MRFGICHFAYVFFALMMMMSISPNTIRLSGGNENKLAVARRLVKVGINDYEEPGASVKHRPAPPGDEFGDKAQDHQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G47295 unknown protein Potri.009G047200 0 1
AT2G37030 SAUR-like auxin-responsive pro... Potri.008G037900 17.14 0.7598 SAUR40
AT1G25275 unknown protein Potri.015G116800 20.14 0.7685
Potri.004G011201 22.64 0.7089
AT1G03050 ENTH/ANTH/VHS superfamily prot... Potri.006G118100 22.84 0.7115
AT1G77060 Phosphoenolpyruvate carboxylas... Potri.002G073600 28.98 0.7176
Potri.001G165360 35.83 0.6480
AT2G33640 DHHC-type zinc finger family p... Potri.005G254366 40.98 0.6446
AT3G14470 NB-ARC domain-containing disea... Potri.017G144481 43.89 0.6817
Potri.008G216423 44.79 0.6163
Potri.014G003551 45.46 0.6770

Potri.009G047200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.