Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07600 79 / 2e-19 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 68 / 3e-15 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G20180 59 / 4e-12 Copper transport protein family (.1) AT4G05030 55 / 6e-11 Copper transport protein family (.1) AT1G55790 46 / 3e-07 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048400 [exp] 196 / 2e-66 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 195 / 3e-66 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171300 [exp] 172 / 1e-56 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 170 / 4e-56 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G001800 [exp] 66 / 3e-15 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.001G468500 [exp] 64 / 2e-14 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.001G378700 [exp] 64 / 4e-14 AT3G20180 56 / 5e-11 Copper transport protein family (.1) Potri.006G001900 [exp] 62 / 5e-14 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.018G023600 [exp] 62 / 2e-12 AT2G20142 86 / 7e-19 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016061 [exp] 97 / 2e-27 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 97 / 3e-27 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016062 [exp] 92 / 4e-25 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 86 / 9e-23 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016060 [exp] 81 / 7e-21 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016063 [exp] 80 / 2e-20 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10025182 [exp] 75 / 3e-18 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016059 [exp] 74 / 3e-18 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10025179 [exp] 69 / 3e-16 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10039093 [exp] 37 / 0.0005 AT4G05030 72 / 3e-18 Copper transport protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G048300.1 pacid=42771426 polypeptide=Potri.009G048300.1.p locus=Potri.009G048300 ID=Potri.009G048300.1.v4.1 annot-version=v4.1 ATGAAGCAAAAGATAGTGATCAAGGTGACGGGGAATGGACCGAAGTCACGCACCAAAGCCTTGCGGATTGCAGTTGGGCTTTCAGGTGTTGAATCTGCTC GTTTAGGAGGGGAAGATAAGAGCCAGATAGAGGTGGTAGGCGATGGAGTTGATGCAGTACAACTTACAAATTTGCTGAGAAAGAAAGTAGGCTACGCAGA GTTAGCAAGTGTAGAAGCTGTGGGAGAAAAGAAAGAAGAGAAGAAAGAAGAGCCAGCAGTGCAGCCGGTTGTTTGGCCCGTGTTTGGTGGAGGCATGCCT CAGACCTATATCTATCCGATTCACCCCCATCAGGACCCTTCTTGCTCCATCATGTAA
AA sequence Show only first row Show all	>Potri.009G048300.1 pacid=42771426 polypeptide=Potri.009G048300.1.p locus=Potri.009G048300 ID=Potri.009G048300.1.v4.1 annot-version=v4.1 MKQKIVIKVTGNGPKSRTKALRIAVGLSGVESARLGGEDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASVEAVGEKKEEKKEEPAVQPVVWPVFGGGMP QTYIYPIHPHQDPSCSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G07600			Heavy metal transport/detoxifi...		Potri.009G048300 [exp]	0	1
					Potri.002G021100 [exp]	1.41	0.9777
AT3G07600			Heavy metal transport/detoxifi...		Potri.009G048400 [exp]	4.69	0.9711
AT5G36930			Disease resistance protein (TI...		Potri.019G003285 [exp]	8.48	0.9522
AT3G10080			RmlC-like cupins superfamily p...		Potri.010G238100 [exp]	9.53	0.9431
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Potri.011G131001 [exp]	11.48	0.9584
					Potri.007G076600 [exp]	13.26	0.9317
AT1G49770	bHLH	ZOU, RGE1, bHLH...	ZHOUPI, RETARDED GROWTH OF EMB...		Potri.001G305100 [exp]	14.35	0.8744
AT2G26110			Protein of unknown function (D...		Potri.001G008080 [exp]	19.77	0.9291
AT4G08250	GRAS		GRAS family transcription fact...		Potri.005G190300 [exp]	24.73	0.9348	GRAS43
					Potri.003G071050 [exp]	25.69	0.9491

Compare expression of checked genes

Potri.009G048300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.