Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G30880 68 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G56480 50 / 9e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G32280 47 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13295 37 / 0.001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048900 [exp] 177 / 1e-58 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049000 [exp] 176 / 3e-58 AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049300 [exp] 103 / 2e-29 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G023300 [exp] 81 / 1e-20 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023200 [exp] 76 / 1e-18 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G044500 [exp] 41 / 2e-05 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 40 / 6e-05 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G084000 [exp] 39 / 0.0002 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019030 [exp] 66 / 1e-14 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 65 / 2e-14 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 61 / 8e-13 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019029 [exp] 61 / 1e-12 AT4G33550 106 / 7e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005010 [exp] 57 / 9e-12 AT4G33550 89 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019770 [exp] 58 / 1e-11 AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016357 [exp] 56 / 7e-11 AT4G30880 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10013030 [exp] 37 / 0.0007 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.009G048800.2 pacid=42772146 polypeptide=Potri.009G048800.2.p locus=Potri.009G048800 ID=Potri.009G048800.2.v4.1 annot-version=v4.1 ATGGCAACGACCAATACTCATCGTCGTCATGTATTGGCCCTGGCAGTGTTCTTGATTGTTGGAATTCATATTCTGGGCAACCAAAAGGTGGCAGCCTCAT GCAAAGAAAGTACTGTTCCTTCTCTCAAATCCAGATGCTCCCGATTCGTTCGAATTCCAGGCCCAAAAGTTCCACCATCTTACGCTTGTTGTCAAGCGGT GAAAGAAATCACAGTAGGAGACCTTCCTTGTTTGTGCAAGCTTCTTACCCCAGCTGTGCAAAAGGTGATTAGCATGGAGAAGGCTGTCTGTGTTGCACGA ACTTGTGGCCTTCCTGTCCCTCCAGGAACTGTATGTGGAAGTAAGTCTATCTATTACTGTCTAGAATATTTCACAGTTTTAATTAATTTTACATAA
AA sequence Show only first row Show all	>Potri.009G048800.2 pacid=42772146 polypeptide=Potri.009G048800.2.p locus=Potri.009G048800 ID=Potri.009G048800.2.v4.1 annot-version=v4.1 MATTNTHRRHVLALAVFLIVGIHILGNQKVAASCKESTVPSLKSRCSRFVRIPGPKVPPSYACCQAVKEITVGDLPCLCKLLTPAVQKVISMEKAVCVAR TCGLPVPPGTVCGSKSIYYCLEYFTVLINFT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33550			Bifunctional inhibitor/lipid-t...		Potri.009G048800 [exp]	0	1
AT4G22080		RHS14	root hair specific 14 (.1)		Potri.004G007300 [exp]	2.82	0.8836
AT1G43730			RNA-directed DNA polymerase (r...		Potri.004G000150 [exp]	4.00	0.8261
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.006G005000 [exp]	4.00	0.8836
					Potri.011G103966 [exp]	4.79	0.6316
AT3G02100			UDP-Glycosyltransferase superf...		Potri.010G084900 [exp]	7.34	0.8545
AT5G46160			Ribosomal protein L14p/L23e fa...		Potri.003G096525 [exp]	9.27	0.5457
AT2G47485			unknown protein		Potri.010G119200 [exp]	10.95	0.5536
AT5G13620			unknown protein		Potri.008G045000 [exp]	10.95	0.7828
					Potri.007G009000 [exp]	13.49	0.7254
AT5G26330			Cupredoxin superfamily protein...		Potri.006G259000 [exp]	13.96	0.7237

Compare expression of checked genes

Potri.009G048800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.