Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G33550 73 / 1e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G32280 50 / 6e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G56480 50 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13295 43 / 5e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048900 [exp] 197 / 5e-67 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048800 [exp] 176 / 4e-58 AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G049300 [exp] 112 / 4e-33 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G023300 [exp] 84 / 3e-22 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023200 [exp] 75 / 1e-18 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G084000 [exp] 47 / 9e-08 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019029 [exp] 75 / 3e-18 AT4G33550 106 / 7e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 67 / 3e-15 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 66 / 4e-15 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005010 [exp] 65 / 5e-15 AT4G33550 89 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019030 [exp] 66 / 1e-14 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10016357 [exp] 61 / 4e-13 AT4G30880 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019770 [exp] 61 / 6e-13 AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.009G049000.1 pacid=42771886 polypeptide=Potri.009G049000.1.p locus=Potri.009G049000 ID=Potri.009G049000.1.v4.1 annot-version=v4.1 ATGGCAACCACTAATACTCATCGTCATGGATTGGCCTTGGCAATGTTGTTGATCGTCGGAATCCATATTCTGGGCAACCAAAAGGTGGCAGCCTCATGCA ACGAAACTGTTACTTCTCTCGTATCCAAATGCTCCCAATTCGTTCGAATTCCAGGCCCAAGAGTCCTACCCTCTGACGCTTGTTGTCAAGCGGCGAAACA AGTCACAGTAGGAGACCTTCCTTGTGTGTGCAAGCTTGTTACCCCAGCTACGCAAAAGGTGTTTAGCATGGACAAGGCGGTCTTTGTTGCACGAACTTGT GGCCTTACTATCCCACCAGGAACTGTATGCGGAAGTTACACCGTTCCTCCTAATTTTGTTTGA
AA sequence Show only first row Show all	>Potri.009G049000.1 pacid=42771886 polypeptide=Potri.009G049000.1.p locus=Potri.009G049000 ID=Potri.009G049000.1.v4.1 annot-version=v4.1 MATTNTHRHGLALAMLLIVGIHILGNQKVAASCNETVTSLVSKCSQFVRIPGPRVLPSDACCQAAKQVTVGDLPCVCKLVTPATQKVFSMDKAVFVARTC GLTIPPGTVCGSYTVPPNFV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30880			Bifunctional inhibitor/lipid-t...		Potri.009G049000 [exp]	0	1
					Potri.010G110751 [exp]	7.34	0.9556
AT5G52640		AtHsp90-1, ATHS...	HEAT SHOCK PROTEIN 83, HEAT SH...		Potri.004G073600 [exp]	8.12	0.9557
AT4G03220			Protein with RNI-like/FBD-like...		Potri.013G151200 [exp]	11.83	0.9405
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Potri.013G089200 [exp]	12.00	0.9520
AT1G03070			Bax inhibitor-1 family protein...		Potri.005G214000 [exp]	13.60	0.9487
AT2G26150	HSF	ATHSFA2	heat shock transcription facto...		Potri.006G226800 [exp]	14.69	0.9439
AT5G48570		ROF2, ATFKBP65	FKBP-type peptidyl-prolyl cis-...		Potri.014G149400 [exp]	21.21	0.9378
AT2G32120		HSP70T-2	heat-shock protein 70T-2 (.1.2...		Potri.010G088600 [exp]	22.04	0.9389
AT3G10020			unknown protein		Potri.013G014300 [exp]	22.97	0.9344
					Potri.004G234150 [exp]	24.33	0.9289

Compare expression of checked genes

Potri.009G049000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.