Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-UBC19.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20060 297 / 2e-104 UBC19 ubiquitin-conjugating enzyme19 (.1.2) AT1G50490 295 / 9e-104 UBC20 ubiquitin-conjugating enzyme 20 (.1) AT1G14400 133 / 3e-40 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT2G02760 133 / 4e-40 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT5G62540 130 / 8e-39 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT2G16740 121 / 2e-35 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 121 / 2e-35 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT1G78870 119 / 2e-34 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) AT1G64230 117 / 6e-34 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT4G27960 117 / 8e-34 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G254500 [exp] 350 / 3e-125 AT3G20060 295 / 1e-103 ubiquitin-conjugating enzyme19 (.1.2) Potri.008G041300 [exp] 235 / 9e-80 AT3G20060 223 / 7e-75 ubiquitin-conjugating enzyme19 (.1.2) Potri.010G220600 [exp] 230 / 5e-78 AT3G20060 216 / 3e-72 ubiquitin-conjugating enzyme19 (.1.2) Potri.013G064400 [exp] 134 / 1e-40 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G064000 [exp] 132 / 1e-39 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 132 / 1e-39 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.011G168200 [exp] 121 / 2e-35 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G471200 [exp] 121 / 2e-35 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G083800 [exp] 120 / 6e-35 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005014 [exp] 299 / 4e-105 AT3G20060 292 / 1e-102 ubiquitin-conjugating enzyme19 (.1.2) Lus10019034 [exp] 299 / 4e-105 AT3G20060 292 / 1e-102 ubiquitin-conjugating enzyme19 (.1.2) Lus10036727 [exp] 135 / 1e-40 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 135 / 1e-40 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 135 / 1e-40 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 133 / 6e-40 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10028700 [exp] 122 / 1e-35 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10009422 [exp] 122 / 1e-35 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10027846 [exp] 120 / 4e-35 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10017654 [exp] 120 / 5e-35 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF05773 [poplar] [flax] RWD RWD domain
Representative CDS sequence Show only first row Show all	>Potri.009G049600.1 pacid=42771283 polypeptide=Potri.009G049600.1.p locus=Potri.009G049600 ID=Potri.009G049600.1.v4.1 annot-version=v4.1 ATGGCAGCTATTAATGGGCATACTCCGGTGGCTGCTCCGGCAGGGACTACCCCATCAAAACAGACTGTCCCATCGGCAAAGACTGTTGATACACAATCCG TGCTTAAACGGTTGCAATCTGAACTGATGGCGTTGATGATGAGTGGAGAATCTGGGATATCTGCCTTCCCTGAAGGGGACAACATATTTTGCTGGAAAGG AACAATCACAGGAAGCAAAGACACTGTTTTTGAAGGAACAGAATACAAACTATCCCTTTCCTTCCCTAATGACTACCCTTTCAAGCCACCAAAGGTCAAG TTTGAAACCAGCTGCTTCCATCCCAATGTGGATGTCTATGGCAACATTTGCTTGGATATTCTTCAGGATAAATGGTCATCTGCCTATGATGTGAGGACAA TATTGCTATCAATCCAAAGTCTGCTTGGAGAGCCAAACATAAGTTCACCTCTAAACACTCAAGCAGCACAACTTTGGAGCAATCAAGAAGAATACAGGAA AATGGTGGAGAAGTTGTACAAGCCTCCAAGTGCTGCATAG
AA sequence Show only first row Show all	>Potri.009G049600.1 pacid=42771283 polypeptide=Potri.009G049600.1.p locus=Potri.009G049600 ID=Potri.009G049600.1.v4.1 annot-version=v4.1 MAAINGHTPVAAPAGTTPSKQTVPSAKTVDTQSVLKRLQSELMALMMSGESGISAFPEGDNIFCWKGTITGSKDTVFEGTEYKLSLSFPNDYPFKPPKVK FETSCFHPNVDVYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNTQAAQLWSNQEEYRKMVEKLYKPPSAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G20060		UBC19	ubiquitin-conjugating enzyme19...		Potri.009G049600 [exp]	0	1	Pt-UBC19.1
AT1G31335			unknown protein		Potri.003G148100 [exp]	1.41	0.9682
AT4G35730			Regulator of Vps4 activity in ...		Potri.007G059800 [exp]	4.47	0.9591
AT5G16250			unknown protein		Potri.008G078000 [exp]	5.19	0.9682
AT1G04030			unknown protein		Potri.002G258501 [exp]	6.32	0.9641
AT5G16250			unknown protein		Potri.019G113300 [exp]	7.21	0.9643
AT4G08330			unknown protein		Potri.005G070600 [exp]	8.48	0.9616
					Potri.006G056000 [exp]	9.69	0.9243
AT3G52110			unknown protein		Potri.001G267600 [exp]	10.48	0.9454
AT3G02120			hydroxyproline-rich glycoprote...		Potri.017G094200 [exp]	10.67	0.9634
AT4G12420		SKU5	Cupredoxin superfamily protein...		Potri.003G112700 [exp]	10.90	0.9496	Pt-SKU5.1

Compare expression of checked genes

Potri.009G049600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.