Potri.009G049900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29500 153 / 2e-48 HSP20-like chaperones superfamily protein (.1)
AT1G07400 144 / 9e-45 HSP20-like chaperones superfamily protein (.1)
AT1G59860 131 / 8e-40 HSP20-like chaperones superfamily protein (.1)
AT1G53540 125 / 2e-37 HSP20-like chaperones superfamily protein (.1)
AT5G59720 125 / 2e-37 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1)
AT3G46230 124 / 5e-37 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
AT4G10250 96 / 2e-25 ATHSP22.0 HSP20-like chaperones superfamily protein (.1)
AT5G37670 76 / 6e-18 HSP15.7CI HSP20-like chaperones superfamily protein (.1)
AT5G12020 72 / 2e-16 HSP17.6II 17.6 kDa class II heat shock protein (.1)
AT2G19310 71 / 4e-16 HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G049800 194 / 2e-64 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1)
Potri.004G187450 169 / 1e-54 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1)
Potri.009G039200 169 / 2e-54 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
Potri.009G148000 165 / 4e-53 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1)
Potri.019G081250 165 / 5e-53 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1)
Potri.019G081200 164 / 2e-52 AT2G29500 186 / 3e-61 HSP20-like chaperones superfamily protein (.1)
Potri.004G187400 163 / 3e-52 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1)
Potri.004G187202 160 / 4e-51 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1)
Potri.009G147900 159 / 8e-51 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040723 157 / 1e-49 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1)
Lus10040722 150 / 3e-47 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016456 150 / 3e-47 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016457 150 / 6e-47 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1)
Lus10016458 146 / 1e-45 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1)
Lus10009085 134 / 1e-40 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Lus10040830 115 / 4e-33 AT1G53540 236 / 6e-81 HSP20-like chaperones superfamily protein (.1)
Lus10000932 93 / 5e-24 AT4G10250 200 / 2e-65 HSP20-like chaperones superfamily protein (.1)
Lus10026262 92 / 7e-24 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1)
Lus10040560 92 / 1e-23 AT4G10250 200 / 1e-65 HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Potri.009G049900.2 pacid=42772416 polypeptide=Potri.009G049900.2.p locus=Potri.009G049900 ID=Potri.009G049900.2.v4.1 annot-version=v4.1
ATGGCAATGATCCCAAGCTTCTTCAACAACCGATCACGAGACATCATCTTCGACCCGTTCTCTTCTTTCGATCCATTCAAGGACTTCCCTTTCCCTTCAT
CTCCCCTCATCCCTCGCGAGAATTCAGCTCTCGTTAACACTCGCATTGACTGGACAGAGACCCCAGAGGCCCATGTATTCAAAGCAGATCTCCCGGGGCT
TAAAAAGGAGGAAGTGAAAGTCGAGATCGAAGATGACAGGGTGCTTCAAATTAGCGGGGAGAGGAACGTGGAGAAGGAAGACATGAATGATACATGGCAT
CGTGTTGAACGTAGCAGTGGCAAGTTCTTGAGAAGGTTCAAACTGCCTGAGAATGTCAAGACAGATCAAGTCAAGGCTGGTATGGAAAACGGGGTGCTTA
CTGTCACTGTGCCTAAGAAGGAAGTCAAGAAACCAGATGCCAAGAAGACTATTGAAATCTCCGGTTAA
AA sequence
>Potri.009G049900.2 pacid=42772416 polypeptide=Potri.009G049900.2.p locus=Potri.009G049900 ID=Potri.009G049900.2.v4.1 annot-version=v4.1
MAMIPSFFNNRSRDIIFDPFSSFDPFKDFPFPSSPLIPRENSALVNTRIDWTETPEAHVFKADLPGLKKEEVKVEIEDDRVLQISGERNVEKEDMNDTWH
RVERSSGKFLRRFKLPENVKTDQVKAGMENGVLTVTVPKKEVKKPDAKKTIEISG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G29500 HSP20-like chaperones superfam... Potri.009G049900 0 1
AT2G29500 HSP20-like chaperones superfam... Potri.009G148000 1.00 0.9989
AT5G12020 HSP17.6II 17.6 kDa class II heat shock p... Potri.006G223900 1.73 0.9935 HSP17.11
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Potri.013G018000 2.44 0.9971 HSP70.11
AT5G59720 HSP18.2 HSP18.1... heat shock protein 18.2 (.1) Potri.008G062350 3.46 0.9935
AT5G11680 unknown protein Potri.003G158200 3.46 0.9876
AT1G54050 HSP20-like chaperones superfam... Potri.003G071100 4.47 0.9847
AT5G15250 FTSH6, ATFTSH6 FTSH protease 6 (.1.2) Potri.017G084000 7.74 0.9831
AT1G16740 Ribosomal protein L20 (.1) Potri.004G095475 8.71 0.9710
AT2G29500 HSP20-like chaperones superfam... Potri.004G187202 8.77 0.9856
AT1G07400 HSP20-like chaperones superfam... Potri.009G039200 8.83 0.9752

Potri.009G049900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.