Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18750 66 / 1e-13 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G27110 66 / 2e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G11290 61 / 7e-12 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G04860 61 / 2e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G03380 60 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G33680 60 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G46790 60 / 3e-11 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G16860 59 / 5e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G57430 59 / 6e-11 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G15510 59 / 7e-11 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G258500 [exp] 189 / 4e-57 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G191000 [exp] 69 / 2e-14 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G184800 [exp] 66 / 1e-13 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G097000 [exp] 65 / 4e-13 AT4G01030 906 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.003G058700 [exp] 65 / 5e-13 AT1G15510 1113 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G047600 [exp] 64 / 8e-13 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G001200 [exp] 63 / 2e-12 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.011G156800 [exp] 63 / 2e-12 AT4G21300 842 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G044700 [exp] 60 / 2e-11 AT3G22690 582 / 0.0 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027366 [exp] 156 / 2e-45 AT2G40720 328 / 7e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036071 [exp] 71 / 5e-15 AT1G18485 464 / 5e-151 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017446 [exp] 68 / 4e-14 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015898 [exp] 64 / 1e-12 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009269 [exp] 64 / 2e-12 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026460 [exp] 63 / 2e-12 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028593 [exp] 63 / 3e-12 AT5G16860 879 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031028 [exp] 62 / 4e-12 AT4G19191 727 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018897 [exp] 62 / 5e-12 AT5G16860 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025009 [exp] 61 / 2e-11 AT1G15510 1020 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.009G053632.1 pacid=42772564 polypeptide=Potri.009G053632.1.p locus=Potri.009G053632 ID=Potri.009G053632.1.v4.1 annot-version=v4.1 ATGAGATCTGGGTTTGAACTAACTTCACGTACTTTGGTTGCACTGCTTCTGGCGTGTGAAGGGGTGTTGGAATTGAGGTTAGTAAAGGAGATACGTGGGT ATTGTTTGAGGAATGGATATTTTGATATGCTTCCTCACGTGGGTACTGCTTTGGTTGGATTCTATTTGAATCTTGAAGTGAGAGTTTCGAGTCTTGTGTT TGATTTGATGGTTATGATAAGCGAAATGAGTTGGAATGCAATGATTACCGGATATTTTGCTTCAGGGGATTTGGTGAAAGCTTTGGAGCTTTTTGTTCGG ATGCTCGAGGATGGGGCTAAGATTGATTTGGTTACAGTAATGGTTGTGATTCAGCATATGCAGAACTTGGATATCTCGAATTGGGGATGCAAATAA
AA sequence Show only first row Show all	>Potri.009G053632.1 pacid=42772564 polypeptide=Potri.009G053632.1.p locus=Potri.009G053632 ID=Potri.009G053632.1.v4.1 annot-version=v4.1 MRSGFELTSRTLVALLLACEGVLELRLVKEIRGYCLRNGYFDMLPHVGTALVGFYLNLEVRVSSLVFDLMVMISEMSWNAMITGYFASGDLVKALELFVR MLEDGAKIDLVTVMVVIQHMQNLDISNWGCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27110			Tetratricopeptide repeat (TPR)...		Potri.009G053632 [exp]	0	1
					Potri.015G058750 [exp]	61.18	0.3984
AT1G76750			Protein of unknown function (D...		Potri.003G191800 [exp]	73.66	0.4064
					Potri.002G093000 [exp]	77.57	0.3848
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.002G038100 [exp]	77.74	0.3619	Pt-GY4.1
AT2G39740		HESO1	HEN1 suppressor 1, Nucleotidyl...		Potri.008G059301 [exp]	141.24	0.4052
					Potri.001G135925 [exp]	254.60	0.3573

Compare expression of checked genes

Potri.009G053632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.