Plant FIBer expression Database

Potri.009G058050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.009G058050.1 pacid=42772541 polypeptide=Potri.009G058050.1.p locus=Potri.009G058050 ID=Potri.009G058050.1.v4.1 annot-version=v4.1
ATGCATGTTGCCGATTCTCTGGCATTTAGCAGTAATCTTGCAAAAATCGCAGTCGCAACCAGGCTACACAGAGTTAAGGACTCAAGGCACAATCGAGAGA
TAGGAATGTTCTTCACTGTCTCGGGCTATATGTTTTCAATGAAAAAATGTAGACCCCAAATAGCAAGGCAAGGAAGAAAAATGACATCAATTATCTGCGA
TGTCAATTTTCTTTGA
AA sequence
>Potri.009G058050.1 pacid=42772541 polypeptide=Potri.009G058050.1.p locus=Potri.009G058050 ID=Potri.009G058050.1.v4.1 annot-version=v4.1
MHVADSLAFSSNLAKIAVATRLHRVKDSRHNREIGMFFTVSGYMFSMKKCRPQIARQGRKMTSIICDVNFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G058050
[exp]
0 1
AT5G39130 RmlC-like cupins superfamily p... Potri.004G180200
[exp]
6.32 0.9488
AT5G39130 RmlC-like cupins superfamily p... Potri.004G180000
[exp]
7.00 0.9587
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Potri.009G161500
[exp]
8.94 0.7820
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Potri.001G092900
[exp]
15.19 0.7812 Pt-WRKY41.1
AT2G38600 HAD superfamily, subfamily III... Potri.016G139700
[exp]
15.81 0.7564
AT3G24310 MYB MYB305, ATMYB71 MYB DOMAIN PROTEIN 71, myb dom... Potri.008G173400
[exp]
16.12 0.8614 Pt-MYB305.1
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Potri.013G045200
[exp]
16.43 0.8429
AT5G23260 MADS ABS, TT16, AGL3... TRANSPARENT TESTA16, AGAMOUS-l... Potri.015G125501
[exp]
16.49 0.8419
AT1G73260 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TR... Potri.007G111800
[exp]
19.44 0.8448
AT3G24310 MYB MYB305, ATMYB71 MYB DOMAIN PROTEIN 71, myb dom... Potri.010G064000
[exp]
26.40 0.8011 Pt-MYB305.2

Potri.009G058050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.