Potri.009G059100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52070 67 / 2e-15 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029504 125 / 3e-38 AT3G52070 62 / 1e-13 unknown protein
Lus10039603 123 / 2e-37 AT3G52070 61 / 4e-13 unknown protein
PFAM info
Representative CDS sequence
>Potri.009G059100.1 pacid=42771746 polypeptide=Potri.009G059100.1.p locus=Potri.009G059100 ID=Potri.009G059100.1.v4.1 annot-version=v4.1
ATGGCAGCTCTCTCAATAGTTCATTCTCTCCATGGTAGTTATAGTTCAATTCAAGAACTGAGAACCAGAAACTGCCCGAGAATCCTCATTCTTTTGTCTT
GCCAAAGAGGCGAGCCAATAGACACCTCCAGCTCAAAACCAAAGAAAGAAATCAAGCAAGACAAGCAACTGGTGAGGCAACTCTTTGGTAGTGTAGAGAA
CTTTGGGAAGGGATTGAAGGACAGTTTGAGCCCTAAGCGGAAGGGTGACTGGAAAGACGTGATGCTGATGAGTTTGTCATTTGCTGTTTATGTGTACATG
TCCCAAAAGATTGTCTGTGCATATTGTGCTTGGATGTCCATGCTCAAGCAATGGTAG
AA sequence
>Potri.009G059100.1 pacid=42771746 polypeptide=Potri.009G059100.1.p locus=Potri.009G059100 ID=Potri.009G059100.1.v4.1 annot-version=v4.1
MAALSIVHSLHGSYSSIQELRTRNCPRILILLSCQRGEPIDTSSSKPKKEIKQDKQLVRQLFGSVENFGKGLKDSLSPKRKGDWKDVMLMSLSFAVYVYM
SQKIVCAYCAWMSMLKQW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G52070 unknown protein Potri.009G059100 0 1
AT3G57680 Peptidase S41 family protein (... Potri.006G055400 2.23 0.9617
AT5G22510 INV-E, At-A/N-I... Arabidopsis alkaline/neutral i... Potri.010G236100 2.44 0.9609
AT3G45310 Cysteine proteinases superfami... Potri.006G141700 3.87 0.9547 Pt-ELSA.1
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Potri.017G032500 4.58 0.9606 ZOG1.12
AT1G05560 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP... Potri.002G236400 5.91 0.9487 IAGLU.2
AT1G13680 PLC-like phosphodiesterases su... Potri.011G144900 6.00 0.9588
AT1G05675 UDP-Glycosyltransferase superf... Potri.017G032300 7.74 0.9524
AT4G27680 P-loop containing nucleoside t... Potri.011G055212 11.22 0.9325
AT1G02260 Divalent ion symporter (.1) Potri.017G141800 11.48 0.9406
AT3G50770 CML41 calmodulin-like 41 (.1) Potri.005G128100 12.00 0.9423

Potri.009G059100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.