Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78960 54 / 1e-10 ATLUP2 lupeol synthase 2 (.1) AT1G78970 53 / 2e-10 ATLUP1, LUP1 ARABIDOPSIS THALIANA LUPEOL SYNTHASE 1, lupeol synthase 1 (.1.2) AT1G66960 51 / 2e-09 ATLUP5 Terpenoid cyclases family protein (.1) AT1G78950 50 / 3e-09 ATLUP3 Terpenoid cyclases family protein (.1) AT1G78955 47 / 3e-08 CAMS1 camelliol C synthase 1 (.1) AT4G15340 44 / 4e-07 04C11, ATPEN1 pentacyclic triterpene synthase 1 (.1) AT2G07050 44 / 5e-07 CAS1 cycloartenol synthase 1 (.1) AT4G15370 42 / 2e-06 BARS1, ATPEN2 PENTACYCLIC TRITERPENE SYNTHASE 2, baruol synthase 1 (.1) AT1G78500 41 / 5e-06 ATPEN6 Terpenoid cyclases family protein (.1) AT5G48010 39 / 4e-05 AtTHAS1, THAS1, THAS, ATPEN4 Arabidopsis thaliana thalianol synthase 1, thalianol synthase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G085000 [exp] 54 / 1e-10 AT1G78955 932 / 0.0 camelliol C synthase 1 (.1) Potri.014G001500 [exp] 53 / 4e-10 AT1G78955 1064 / 0.0 camelliol C synthase 1 (.1) Potri.004G132500 [exp] 52 / 5e-10 AT1G78955 935 / 0.0 camelliol C synthase 1 (.1) Potri.007G002500 [exp] 52 / 5e-10 AT1G78950 1244 / 0.0 Terpenoid cyclases family protein (.1) Potri.014G002400 [exp] 52 / 8e-10 AT1G78950 1245 / 0.0 Terpenoid cyclases family protein (.1) Potri.019G079200 [exp] 52 / 8e-10 AT1G78955 548 / 0.0 camelliol C synthase 1 (.1) Potri.001G049100 [exp] 52 / 1e-09 AT1G78955 1141 / 0.0 camelliol C synthase 1 (.1) Potri.007G002100 [exp] 49 / 1e-08 AT1G78955 1074 / 0.0 camelliol C synthase 1 (.1) Potri.014G002500 [exp] 47 / 4e-08 AT1G78955 909 / 0.0 camelliol C synthase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013546 [exp] 53 / 4e-10 AT1G78955 1081 / 0.0 camelliol C synthase 1 (.1) Lus10016441 [exp] 52 / 7e-10 AT1G78955 1035 / 0.0 camelliol C synthase 1 (.1) Lus10016438 [exp] 52 / 7e-10 AT1G78950 298 / 1e-96 Terpenoid cyclases family protein (.1) Lus10016440 [exp] 52 / 8e-10 AT1G78950 838 / 0.0 Terpenoid cyclases family protein (.1) Lus10016439 [exp] 52 / 1e-09 AT1G78960 874 / 0.0 lupeol synthase 2 (.1) Lus10019674 [exp] 51 / 2e-09 AT1G78960 577 / 0.0 lupeol synthase 2 (.1) Lus10019673 [exp] 49 / 1e-08 AT1G78955 395 / 6e-133 camelliol C synthase 1 (.1) Lus10026079 [exp] 49 / 1e-08 AT1G78955 1002 / 0.0 camelliol C synthase 1 (.1) Lus10025684 [exp] 44 / 9e-07 AT2G07050 1198 / 0.0 cycloartenol synthase 1 (.1) Lus10032146 [exp] 44 / 9e-07 AT2G07050 1346 / 0.0 cycloartenol synthase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G064950.1 pacid=42770950 polypeptide=Potri.009G064950.1.p locus=Potri.009G064950 ID=Potri.009G064950.1.v4.1 annot-version=v4.1 ATGGCTTCCCATTCCTTGTTCAGACTCAGGAGTATGCATCGTCTCATTTCCAGAGAAGCATGGACTCTCTCCATCAAAGATCATGGTTGGCAAGTCTCGG ATTGCACAGCTGAAGATCTAAGGGTAAACAAGTTCAATTTCTCTTTGTCGGAGTAA
AA sequence Show only first row Show all	>Potri.009G064950.1 pacid=42770950 polypeptide=Potri.009G064950.1.p locus=Potri.009G064950 ID=Potri.009G064950.1.v4.1 annot-version=v4.1 MASHSLFRLRSMHRLISREAWTLSIKDHGWQVSDCTAEDLRVNKFNFSLSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78960		ATLUP2	lupeol synthase 2 (.1)		Potri.009G064950 [exp]	0	1
AT3G06890			unknown protein		Potri.008G221000 [exp]	1.41	0.9263
AT3G22104			Phototropic-responsive NPH3 fa...		Potri.011G032100 [exp]	6.00	0.8452
					Potri.012G018900 [exp]	6.24	0.8834
					Potri.003G076700 [exp]	7.21	0.8751
AT1G74680			Exostosin family protein (.1)		Potri.002G210000 [exp]	9.38	0.8228
AT5G25570			unknown protein		Potri.006G245100 [exp]	10.95	0.8305
AT4G33670			NAD(P)-linked oxidoreductase s...		Potri.009G081300 [exp]	11.35	0.7991
					Potri.014G192701 [exp]	13.63	0.8516
AT1G05610		APS2	ADP-glucose pyrophosphorylase ...		Potri.007G146100 [exp]	15.65	0.8515
AT2G44930			Plant protein of unknown funct...		Potri.017G019400 [exp]	16.43	0.8296

Compare expression of checked genes

Potri.009G064950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.