Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12190 226 / 4e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G02430 50 / 3e-08 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G35410 50 / 6e-08 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G02840 49 / 8e-08 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT5G08695 49 / 1e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G19610 48 / 3e-07 nucleotide binding;nucleic acid binding;RNA binding (.1) AT1G60000 47 / 4e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G21440 46 / 1e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G09140 45 / 2e-06 ATSRP30.1, ATSRP30.2, SR30, At-SR30 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) AT1G49760 45 / 3e-06 PABP8, PAB8 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G273200 [exp] 247 / 3e-86 AT5G12190 227 / 1e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G024600 [exp] 53 / 4e-09 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.006G190900 [exp] 50 / 4e-08 AT3G15010 179 / 6e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.002G124200 [exp] 48 / 2e-07 AT1G49760 822 / 0.0 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) Potri.014G025400 [exp] 47 / 5e-07 AT1G49760 789 / 0.0 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) Potri.002G214000 [exp] 47 / 6e-07 AT4G03110 506 / 4e-179 RNA-binding protein-defense related 1 (.1.2) Potri.016G048100 [exp] 47 / 6e-07 AT3G15010 181 / 1e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.013G015500 [exp] 46 / 8e-07 AT1G09140 263 / 7e-88 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.014G129900 [exp] 46 / 8e-07 AT1G02840 272 / 5e-91 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026814 [exp] 236 / 4e-82 AT5G12190 225 / 8e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10026815 [exp] 202 / 1e-68 AT5G12190 192 / 9e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10027733 [exp] 52 / 1e-08 AT2G36660 569 / 0.0 poly(A) binding protein 7 (.1) Lus10007869 [exp] 48 / 3e-07 AT1G02840 308 / 1e-105 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10016174 [exp] 48 / 4e-07 AT3G52380 275 / 3e-91 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1) Lus10029885 [exp] 47 / 8e-07 AT1G02840 253 / 2e-81 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10020656 [exp] 47 / 1e-06 AT1G02840 297 / 2e-100 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10002835 [exp] 46 / 1e-06 AT4G34110 918 / 0.0 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) Lus10027886 [exp] 46 / 1e-06 AT4G34110 922 / 0.0 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) Lus10008218 [exp] 45 / 3e-06 AT1G02840 228 / 3e-73 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.009G067500.1 pacid=42771704 polypeptide=Potri.009G067500.1.p locus=Potri.009G067500 ID=Potri.009G067500.1.v4.1 annot-version=v4.1 ATGGCGCAAACAATCAGCCTCCGCAAAGGCAACACCCGTCTCCCACCTGAGGTCAACCGCGTCCTCTACGTCCGTAATCTTCCGTTCAACATATCAAGCG AAGAGATGTACGATATATTCGGCAAATACGGAGCGATTCGTCAAATCCGAATCGGAACCAACAAGGACACGAGAGGCACTGCTTATGTGGTTTATGAAGA TATCTACGATGCCAAAACGGCGGTGGATCACTTGTCAGGGTTTAATGTGGCGAATAGGTATTTGATTGTGCTGTACTATCAGCAAGCGAAGATGAGTAAG AAGTTTGATCAGAAGAAGAAAGAAGAAGAGATTGTTAAGATGCAGGAAAAATATGGCGTTACTACCAAAGATTAG
AA sequence Show only first row Show all	>Potri.009G067500.1 pacid=42771704 polypeptide=Potri.009G067500.1.p locus=Potri.009G067500 ID=Potri.009G067500.1.v4.1 annot-version=v4.1 MAQTISLRKGNTRLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRIGTNKDTRGTAYVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQAKMSK KFDQKKKEEEIVKMQEKYGVTTKD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Potri.009G067500 [exp]	0	1
AT5G23710			DNA binding;DNA-directed RNA p...		Potri.018G000800 [exp]	3.87	0.8897
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Potri.015G135300 [exp]	4.24	0.8749
AT5G27990			Pre-rRNA-processing protein TS...		Potri.013G035000 [exp]	6.63	0.8624
AT1G53530			Peptidase S24/S26A/S26B/S26C f...		Potri.007G071400 [exp]	7.48	0.8703
AT3G54826			Zim17-type zinc finger protein...		Potri.008G037300 [exp]	7.93	0.8928
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Potri.007G127500 [exp]	11.74	0.8524	FTA.1
AT3G24030			hydroxyethylthiazole kinase fa...		Potri.003G174400 [exp]	12.00	0.8966
					Potri.019G045600 [exp]	12.64	0.8949
AT3G17210		ATHS1	A. THALIANA HEAT STABLE PROTEI...		Potri.010G151000 [exp]	16.49	0.8752
AT2G39440			unknown protein		Potri.012G120220 [exp]	17.29	0.8778

Compare expression of checked genes

Potri.009G067500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.