Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	CPN10.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14980 161 / 3e-53 CPN10 chaperonin 10 (.1) AT1G23100 158 / 4e-52 GroES-like family protein (.1) AT5G20720 54 / 8e-10 CHCPN10, ATCPN21, CPN21, CPN20 CHLOROPLAST CHAPERONIN 10, chaperonin 20 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G274300 [exp] 184 / 2e-62 AT1G14980 165 / 6e-55 chaperonin 10 (.1) Potri.008G130500 [exp] 151 / 2e-49 AT1G23100 157 / 7e-52 GroES-like family protein (.1) Potri.010G111600 [exp] 148 / 4e-48 AT1G23100 155 / 1e-50 GroES-like family protein (.1) Potri.018G063200 [exp] 52 / 3e-09 AT5G20720 383 / 5e-136 CHLOROPLAST CHAPERONIN 10, chaperonin 20 (.1.2.3) Potri.006G138600 [exp] 50 / 3e-08 AT5G20720 395 / 1e-140 CHLOROPLAST CHAPERONIN 10, chaperonin 20 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036055 [exp] 132 / 2e-41 AT1G23100 134 / 7e-42 GroES-like family protein (.1) Lus10026822 [exp] 81 / 3e-19 AT2G26810 267 / 5e-87 Putative methyltransferase family protein (.1.2.3) Lus10016196 [exp] 52 / 6e-09 AT5G20720 315 / 7e-108 CHLOROPLAST CHAPERONIN 10, chaperonin 20 (.1.2.3) Lus10021244 [exp] 51 / 8e-09 AT5G20720 372 / 1e-131 CHLOROPLAST CHAPERONIN 10, chaperonin 20 (.1.2.3) Lus10013607 [exp] 50 / 1e-08 AT5G20720 373 / 5e-132 CHLOROPLAST CHAPERONIN 10, chaperonin 20 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0296 [poplar] [flax] GroES PF00166 [poplar] [flax] Cpn10 Chaperonin 10 Kd subunit
Representative CDS sequence Show only first row Show all	>Potri.009G068900.1 pacid=42771409 polypeptide=Potri.009G068900.1.p locus=Potri.009G068900 ID=Potri.009G068900.1.v4.1 annot-version=v4.1 ATGGCAAAGCGTTTGATCCCGACATTTAATCGCATATTGGTGGAGAAAATAATCCCTCCTTCCAAAACCAACACCGGTATTCTTCTTCCTGAGAAAACCC CCAAGATGAATTCTGGAAAAGTTGTTGCGGTGGGTCCCGGAGCTCGTGATAAAGACTGCAAGTTGATTCCTGTTACTCTGAAGGAAGGAGATACTGTTCT TTTGCCTGAATATGGAGGCACTGAAGTGAAACTCGGTGAAAAAGAGTATTTTCTATATCGAGATGAAGATATCATGGGAACTCTTCATGACTAA
AA sequence Show only first row Show all	>Potri.009G068900.1 pacid=42771409 polypeptide=Potri.009G068900.1.p locus=Potri.009G068900 ID=Potri.009G068900.1.v4.1 annot-version=v4.1 MAKRLIPTFNRILVEKIIPPSKTNTGILLPEKTPKMNSGKVVAVGPGARDKDCKLIPVTLKEGDTVLLPEYGGTEVKLGEKEYFLYRDEDIMGTLHD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14980		CPN10	chaperonin 10 (.1)		Potri.009G068900 [exp]	0	1	CPN10.2
AT5G44005			unknown protein		Potri.014G192100 [exp]	2.82	0.8286
AT5G28060			Ribosomal protein S24e family ...		Potri.005G049400 [exp]	3.00	0.8510	Pt-RPS24.1
AT3G58470			nucleic acid binding;methyltra...		Potri.016G063600 [exp]	3.16	0.8526
AT5G13470			unknown protein		Potri.003G203900 [exp]	3.46	0.8532
AT3G13580			Ribosomal protein L30/L7 famil...		Potri.008G008000 [exp]	3.87	0.8355	RPL7.3
AT5G67260		CYCD3;2	CYCLIN D3;2 (.1)		Potri.007G048300 [exp]	4.00	0.8399	Pt-CYCD3.3
AT3G21820		SDG36, ATXR2	SET DOMAIN PROTEIN 36, histone...		Potri.017G038700 [exp]	4.47	0.8108	SDG943
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Potri.001G391400 [exp]	4.89	0.8330	Pt-IE.1
AT5G39850			Ribosomal protein S4 (.1)		Potri.006G209700 [exp]	11.95	0.7914
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.019G014386 [exp]	15.42	0.7897

Compare expression of checked genes

Potri.009G068900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.