Potri.009G069300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19370 281 / 2e-94 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
AT1G26550 48 / 9e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G55130 48 / 6e-06 SIR1, CNX5 SIRTINOL RESISTANT 1, "co-factor for nitrate, reductase and xanthine dehydrogenase 5", co-factor for nitrate, reductase and xanthine dehydrogenase 5 (.1.2)
AT5G66170 42 / 6e-05 STR18 sulfurtransferase 18 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G355800 53 / 1e-07 AT5G55130 683 / 0.0 SIRTINOL RESISTANT 1, "co-factor for nitrate, reductase and xanthine dehydrogenase 5", co-factor for nitrate, reductase and xanthine dehydrogenase 5 (.1.2)
Potri.008G089900 45 / 7e-06 AT1G26550 214 / 1e-72 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.002G014900 44 / 3e-05 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026105 277 / 3e-93 AT5G19370 233 / 8e-76 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Lus10000413 276 / 1e-91 AT5G19370 240 / 1e-77 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Lus10000697 54 / 7e-08 AT5G55130 643 / 0.0 SIRTINOL RESISTANT 1, "co-factor for nitrate, reductase and xanthine dehydrogenase 5", co-factor for nitrate, reductase and xanthine dehydrogenase 5 (.1.2)
Lus10022510 52 / 2e-07 AT5G55130 651 / 0.0 SIRTINOL RESISTANT 1, "co-factor for nitrate, reductase and xanthine dehydrogenase 5", co-factor for nitrate, reductase and xanthine dehydrogenase 5 (.1.2)
Lus10019084 49 / 4e-07 AT1G26550 225 / 4e-77 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10015714 49 / 5e-07 AT1G26550 224 / 1e-76 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10005635 43 / 8e-05 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Lus10012566 40 / 0.0005 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
CL0487 FKBP PF13616 Rotamase_3 PPIC-type PPIASE domain
Representative CDS sequence
>Potri.009G069300.1 pacid=42771127 polypeptide=Potri.009G069300.1.p locus=Potri.009G069300 ID=Potri.009G069300.1.v4.1 annot-version=v4.1
ATGTTAAGAGCATCTCACATCCCACCAGTAGCAACACCAGCACTCTCTGCTCTCAAAATCTCTCTGATTCCCGCCCTCTCACTCTCTTCTTCACTTCCTC
ACCTTTACAAACTCTCTACATTTGCTCCACTTCATAATTTCCTTCCAAAAACAGCACCACCCAATTCATCTCCTATCTCCTTCAAAAGGTTCTTACCAAT
GTTGGGTCACCACCCTTGTCCCAAAGCTTCGTTTAGTTCTGGGAGCGGCACTGGAGGTGGAAGAGAGTTATTGGTGCAGCACTTGCTTGTTAAAGAAGAT
GACCTCAAGCTTTTGTTGGAGCTTCAACAGAGAATTTCAGGAGGAGGAGAGGATTTGAGTGACCTTGCAGTGGAATACTCATTATGTCCATCAAAAGAAG
AAGGGGGGATGCTTGGCTGGGTTAGAAAAGGGCAAATGGTACCAGAATTTGAGGAAGCTGCTTTTAGTGCCCCTTTGAACAAAGTTGTAAGGTGTAAAAC
TAAATTTGGGTGGCATTTGTTGCAAGTTATTTCTGAGAGGGAAGAATCTCTACTTGGGGAAATTCAAGCGGATGAGCTCCATGTAAAAATCCAAGATCCT
ACATTTGCCAAAGAAGCTCAATTGATTGATGTTCGAGAACCTGATGAAGTGGCCAAAGCTTCATTGCCAGGTTTTGAAGTACTTCCCCTCCGCCAGTTTG
GAAGCTGGGGACCAGAAGTTACAACCAAGTTTGATCCTGAAAAGGATACTTATGTTATGTGTCACCATGGGATGCGGTCACTACAGGTTGCTAAGTGGTT
GCAGTCTCAGGGTTTCAAGAGAGTATTTAATGTGTCCGGGGGCATACATGCATACGCTGTCAGGGTCGATCCATCAATTCCTACGTACTGA
AA sequence
>Potri.009G069300.1 pacid=42771127 polypeptide=Potri.009G069300.1.p locus=Potri.009G069300 ID=Potri.009G069300.1.v4.1 annot-version=v4.1
MLRASHIPPVATPALSALKISLIPALSLSSSLPHLYKLSTFAPLHNFLPKTAPPNSSPISFKRFLPMLGHHPCPKASFSSGSGTGGGRELLVQHLLVKED
DLKLLLELQQRISGGGEDLSDLAVEYSLCPSKEEGGMLGWVRKGQMVPEFEEAAFSAPLNKVVRCKTKFGWHLLQVISEREESLLGEIQADELHVKIQDP
TFAKEAQLIDVREPDEVAKASLPGFEVLPLRQFGSWGPEVTTKFDPEKDTYVMCHHGMRSLQVAKWLQSQGFKRVFNVSGGIHAYAVRVDPSIPTY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G19370 rhodanese-like domain-containi... Potri.009G069300 0 1
AT1G08640 CJD1 Chloroplast J-like domain 1 (.... Potri.013G046200 2.23 0.9375
AT5G07900 Mitochondrial transcription te... Potri.004G013000 3.46 0.9204
AT1G02560 NCLPP5, NCLPP1,... NUCLEAR CLPP 5, NUCLEAR-ENCODE... Potri.002G195200 8.06 0.9213 CLPP5.2
AT5G59500 protein C-terminal S-isoprenyl... Potri.001G242400 8.12 0.9136
AT3G07330 ATCSLC6, ATCSLC... CELLULOSE-SYNTHASE LIKE C6, Ce... Potri.014G190900 13.11 0.8815
AT5G13120 Pnsl5, ATCYP20-... Photosynthetic NDH subcomplex... Potri.001G060200 13.52 0.9249
AT3G21200 PGR7 proton gradient regulation 7 (... Potri.010G250200 14.42 0.9259
AT2G26340 unknown protein Potri.006G220800 15.62 0.9217
AT5G63310 NDPK1A, NDPKIAI... NDP KINASE 1A, NUCLEOSIDE DIPH... Potri.012G093800 19.49 0.9150
AT2G14880 SWIB/MDM2 domain superfamily p... Potri.009G092200 22.36 0.8475

Potri.009G069300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.