Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28340 38 / 0.0002 AtRLP4 receptor like protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G009300 [exp] 70 / 9e-16 AT1G07390 449 / 9e-140 receptor like protein 1 (.1.2.3) Potri.003G027933 [exp] 65 / 1e-14 ND / Potri.003G026914 [exp] 66 / 3e-14 AT1G07390 444 / 1e-137 receptor like protein 1 (.1.2.3) Potri.005G008600 [exp] 65 / 5e-14 AT1G74190 310 / 1e-91 receptor like protein 15 (.1) Potri.005G011600 [exp] 65 / 6e-14 AT1G74190 439 / 1e-135 receptor like protein 15 (.1) Potri.003G028557 [exp] 65 / 6e-14 AT1G07390 388 / 1e-117 receptor like protein 1 (.1.2.3) Potri.005G007900 [exp] 57 / 3e-11 AT1G74170 430 / 5e-132 receptor like protein 13 (.1) Potri.005G006701 [exp] 57 / 4e-11 AT1G74190 438 / 3e-136 receptor like protein 15 (.1) Potri.003G013700 [exp] 56 / 6e-11 AT2G25470 366 / 2e-110 receptor like protein 21 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030068 [exp] 46 / 3e-07 AT5G49290 397 / 3e-124 receptor like protein 56 (.1) Lus10032058 [exp] 39 / 0.0001 AT5G14210 873 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10035225 [exp] 39 / 0.0001 AT5G14210 854 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10015320 [exp] 39 / 0.0001 AT1G28340 895 / 0.0 receptor like protein 4 (.1) Lus10008712 [exp] 36 / 0.0008 AT4G08850 1009 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2) Lus10029659 [exp] 36 / 0.0009 AT5G63410 584 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G069751.1 pacid=42770776 polypeptide=Potri.009G069751.1.p locus=Potri.009G069751 ID=Potri.009G069751.1.v4.1 annot-version=v4.1 ATGTATAATTTGCGTAGAGGTAGCTTATTTTTACCTTTTATTTTGCATATGGTGAGACTTACATATAGCAACAAGTCTTTTGCTGGTATTGAGGTCCTAT CATCACAATTGAAGAAGCTAGAGAACCTTGACCTGAGCTTTAATAGATTCAACGATAGCGTTTTATCACATCTGTTTGGATTTTCTTCACTCAAGTATTT AAATCTAACAGGCAATATTTAG
AA sequence Show only first row Show all	>Potri.009G069751.1 pacid=42770776 polypeptide=Potri.009G069751.1.p locus=Potri.009G069751 ID=Potri.009G069751.1.v4.1 annot-version=v4.1 MYNLRRGSLFLPFILHMVRLTYSNKSFAGIEVLSSQLKKLENLDLSFNRFNDSVLSHLFGFSSLKYLNLTGNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.009G069751 [exp]	0	1
AT3G56320			PAP/OAS1 substrate-binding dom...		Potri.019G056800 [exp]	7.07	0.7972
AT1G72390			unknown protein		Potri.003G069200 [exp]	8.36	0.8047
AT3G54280		RGD3, ATBTAF1, ...	ROOT GROWTH DEFECTIVE 3, DNA b...		Potri.013G068400 [exp]	12.60	0.7970
AT4G32360			Pyridine nucleotide-disulphide...		Potri.017G118801 [exp]	14.69	0.7675
AT1G02080			transcription regulators (.1.2...		Potri.002G143000 [exp]	28.00	0.7791
AT2G23740	C2H2ZnF	AtCZS	nucleic acid binding;sequence-...		Potri.005G129800 [exp]	38.41	0.7673
AT1G63700		EMB71, MAPKKK4,...	YODA, MAP KINASE KINASE KINASE...		Potri.001G102900 [exp]	39.39	0.7544
AT4G11670			Protein of unknown function (D...		Potri.001G108400 [exp]	41.56	0.7259
AT1G16800			P-loop containing nucleoside t...		Potri.010G253700 [exp]	45.32	0.7571
AT3G61690			nucleotidyltransferases (.1)		Potri.014G097600 [exp]	45.49	0.7424

Compare expression of checked genes

Potri.009G069751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.