Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02280 267 / 8e-94 SNARE-like superfamily protein (.1) AT1G51160 63 / 4e-13 SNARE-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G149900 [exp] 69 / 2e-15 AT1G51160 332 / 2e-118 SNARE-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023793 [exp] 274 / 2e-96 AT5G02280 261 / 2e-91 SNARE-like superfamily protein (.1) Lus10024390 [exp] 273 / 3e-96 AT5G02280 263 / 4e-92 SNARE-like superfamily protein (.1) Lus10010836 [exp] 271 / 2e-95 AT5G02280 259 / 2e-90 SNARE-like superfamily protein (.1) Lus10039298 [exp] 72 / 2e-16 AT1G51160 323 / 5e-115 SNARE-like superfamily protein (.1.2) Lus10027541 [exp] 72 / 2e-16 AT1G51160 323 / 5e-115 SNARE-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF04628 [poplar] [flax] Sedlin_N Sedlin, N-terminal conserved region
Representative CDS sequence Show only first row Show all	>Potri.009G069800.2 pacid=42771476 polypeptide=Potri.009G069800.2.p locus=Potri.009G069800 ID=Potri.009G069800.2.v4.1 annot-version=v4.1 ATGGCAGCAATTTACAGCCTTTACATCATCAACAAATCAGGTGGTTTGATCTTCTACAAGGATTATGGATCTTCTGGACGGATGGATACAAATGATAGCT TACGAGTAGCTAGTTTATGGCATTCAATGCATGCCATCTCTCAGCAGCTATCACCAACTGTTGGCTGTTTAGGCATTGAACTCCTCGAAGCTGATACCTT TGATCTTCATTGCTTCCAATCACTCACTGGAACAAAGTTCTTTGTGGTGTGTGAACCTGGAACACAGCACATGGAAGGCCTCTTGAAAGTCATATATGAA TTGTACACGGATTATGTCCTAAAGAACCCGTTTTATGAGATGGAGATGCCTATACGATGCGAGCTCTTTGACATCAACCTGTCTCAGGCAATACAGAAGG ATCGTGTTGCTTTATTGGGGCGATGA
AA sequence Show only first row Show all	>Potri.009G069800.2 pacid=42771476 polypeptide=Potri.009G069800.2.p locus=Potri.009G069800 ID=Potri.009G069800.2.v4.1 annot-version=v4.1 MAAIYSLYIINKSGGLIFYKDYGSSGRMDTNDSLRVASLWHSMHAISQQLSPTVGCLGIELLEADTFDLHCFQSLTGTKFFVVCEPGTQHMEGLLKVIYE LYTDYVLKNPFYEMEMPIRCELFDINLSQAIQKDRVALLGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02280			SNARE-like superfamily protein...		Potri.009G069800 [exp]	0	1
AT2G21160			Translocon-associated protein ...		Potri.009G129800 [exp]	1.73	0.9321
AT2G22425			Microsomal signal peptidase 12...		Potri.008G175775 [exp]	2.82	0.9315
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.017G086900 [exp]	4.12	0.9111
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Potri.005G167900 [exp]	6.32	0.9199	Pt-SAH7.2
AT3G59540			Ribosomal L38e protein family ...		Potri.010G181200 [exp]	7.93	0.9185	Pt-RPL38.2
AT2G25310			Protein of unknown function (D...		Potri.006G257100 [exp]	8.77	0.9203
AT1G16170			unknown protein		Potri.001G038200 [exp]	10.24	0.9235
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.006G104500 [exp]	10.95	0.9180
AT4G33910			2-oxoglutarate (2OG) and Fe(II...		Potri.007G052600 [exp]	13.41	0.9089
AT5G61310			Cytochrome c oxidase subunit V...		Potri.002G195901 [exp]	14.00	0.9029

Compare expression of checked genes

Potri.009G069800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.