Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12320 197 / 6e-66 ankyrin repeat family protein (.1) AT4G35450 81 / 1e-18 AKR2A, AFT, AKR2 ankyrin repeat-containing protein 2 (.1.2.3.4.5) AT2G17390 73 / 7e-16 AKR2B ankyrin repeat-containing 2B (.1) AT4G27780 67 / 9e-14 ACBP2 acyl-CoA binding protein 2 (.1) AT2G03430 66 / 9e-14 Ankyrin repeat family protein (.1) AT4G19150 66 / 1e-13 Ankyrin repeat family protein (.1.2) AT3G02850 64 / 2e-12 SKOR STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) AT5G53470 64 / 2e-12 ACBP1 acyl-CoA binding protein 1 (.1) AT5G37500 61 / 3e-11 GORK gated outwardly-rectifying K+ channel, gated outwardly-rectifying K+ channel (.1) AT2G14255 59 / 7e-11 Ankyrin repeat family protein with DHHC zinc finger domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G276100 [exp] 268 / 1e-93 AT5G12320 191 / 1e-63 ankyrin repeat family protein (.1) Potri.010G185200 [exp] 79 / 7e-18 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.012G017700 [exp] 66 / 2e-13 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.013G062000 [exp] 66 / 2e-13 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.003G103400 [exp] 65 / 4e-13 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.001G238800 [exp] 65 / 6e-13 AT2G28840 657 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Potri.002G213200 [exp] 65 / 8e-13 AT2G03430 96 / 2e-22 Ankyrin repeat family protein (.1) Potri.015G010200 [exp] 64 / 1e-12 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1) Potri.004G210000 [exp] 64 / 1e-12 AT2G17390 418 / 1e-146 ankyrin repeat-containing 2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036033 [exp] 236 / 4e-81 AT5G12320 186 / 2e-61 ankyrin repeat family protein (.1) Lus10009696 [exp] 232 / 2e-79 AT5G12320 184 / 7e-61 ankyrin repeat family protein (.1) Lus10001414 [exp] 72 / 1e-15 AT4G19150 245 / 9e-82 Ankyrin repeat family protein (.1.2) Lus10001605 [exp] 67 / 3e-13 AT4G38130 833 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) Lus10035498 [exp] 65 / 3e-13 AT3G02850 206 / 2e-61 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10037694 [exp] 66 / 4e-13 AT3G02850 659 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10015687 [exp] 66 / 5e-13 AT3G02850 1231 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10013859 [exp] 63 / 3e-12 AT2G17390 427 / 1e-150 ankyrin repeat-containing 2B (.1) Lus10009035 [exp] 63 / 4e-12 AT3G23280 524 / 0.0 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10001999 [exp] 62 / 7e-12 AT3G02850 970 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence Show only first row Show all	>Potri.009G070700.1 pacid=42771108 polypeptide=Potri.009G070700.1.p locus=Potri.009G070700 ID=Potri.009G070700.1.v4.1 annot-version=v4.1 ATGGGGACGGCGACAAACCAAGCAGAGCGGCAAACCCAAGTCGAAACAACGCCGGAGATTGTTGATGCTTTACTTGAGGCTGCTAGATATGATGATTTTG AGGATATCACAAGTTTAGCATCTTCTGGGGTTTCTCTTGACTCCAAAGATTCACAGGGCAGAACAGCCCTCCATATGGCTGCAGCTAATGGGCATCTTGA CATTGTGGAGTATCTTATCAATCAAGGAGTGGACCTCAATGCTTCTAATGAGGAGAAGAATACGCCTCTTCATTGGGCCTGTCTCAATGGTCATATAGAG GTTGTTAAGAAATTGATTCTGGCAGGAGCGAGTTTAGGCATTCTTAATAGCCATGAACGGACTCCAATGGATGAAGCTGTTACTAGGGGAAAATTGGATG TTATTGATGCAATTAATGCAGCTGTGGCACAACAGGAACTTTCAGGTGTTACAGTTTCCTAG
AA sequence Show only first row Show all	>Potri.009G070700.1 pacid=42771108 polypeptide=Potri.009G070700.1.p locus=Potri.009G070700 ID=Potri.009G070700.1.v4.1 annot-version=v4.1 MGTATNQAERQTQVETTPEIVDALLEAARYDDFEDITSLASSGVSLDSKDSQGRTALHMAAANGHLDIVEYLINQGVDLNASNEEKNTPLHWACLNGHIE VVKKLILAGASLGILNSHERTPMDEAVTRGKLDVIDAINAAVAQQELSGVTVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G12320			ankyrin repeat family protein ...		Potri.009G070700 [exp]	0	1
AT3G51800		ATEBP1, ATG2, E...	A. THALIANA ERBB-3 BINDING PRO...		Potri.006G102200 [exp]	4.47	0.8321
AT5G37350			Serine/threonine-protein kinas...		Potri.015G096100 [exp]	4.69	0.7926
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.011G149800 [exp]	7.93	0.8152	TIM13.2
AT1G26750			unknown protein		Potri.010G165500 [exp]	14.86	0.7884
AT5G50810		TIM8	translocase inner membrane sub...		Potri.015G102000 [exp]	16.73	0.8269
AT1G09760		U2A'	U2 small nuclear ribonucleopro...		Potri.003G158800 [exp]	19.07	0.7714
AT2G44860			Ribosomal protein L24e family ...		Potri.009G148500 [exp]	24.73	0.7837
AT1G07070			Ribosomal protein L35Ae family...		Potri.008G063200 [exp]	25.21	0.8148
AT1G29250			Alba DNA/RNA-binding protein (...		Potri.006G252000 [exp]	25.69	0.7392
AT3G02220			unknown protein		Potri.004G116800 [exp]	25.80	0.7282

Compare expression of checked genes

Potri.009G070700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.