Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29430 228 / 6e-79 RPS15AE ribosomal protein S15A E (.1) AT2G19720 224 / 2e-77 RPS15AB ribosomal protein S15A B (.1) AT5G59850 134 / 9e-42 Ribosomal protein S8 family protein (.1) AT1G07770 134 / 9e-42 RPS15A ribosomal protein S15A (.1.2) AT2G39590 133 / 3e-41 Ribosomal protein S8 family protein (.1) AT3G46040 132 / 8e-41 RPS15AD ribosomal protein S15A D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G071400 [exp] 267 / 3e-94 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.010G208700 [exp] 136 / 3e-42 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 136 / 3e-42 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.003G114800 [exp] 136 / 3e-42 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 135 / 8e-42 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040543 [exp] 234 / 5e-81 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1) Lus10000975 [exp] 231 / 5e-80 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1) Lus10023429 [exp] 135 / 8e-42 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1) Lus10040309 [exp] 135 / 8e-42 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10043001 [exp] 135 / 8e-42 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10029461 [exp] 135 / 8e-42 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 135 / 8e-42 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10005960 [exp] 135 / 8e-42 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [poplar] [flax] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Potri.009G071250.1 pacid=42771670 polypeptide=Potri.009G071250.1.p locus=Potri.009G071250 ID=Potri.009G071250.1.v4.1 annot-version=v4.1 ATGGGGAGGAGGATATTGAACGATGCCTTGAGGGCAATAGTGAATGCAGAGAGGAGAAGTAAATCTACTGTGGAGTTACAGCCCATTTCTACTGTCACGT CTTCTTTTCTTAAGATCATGAAAGACAGGGGATATATAAAAAACTTTCATGTTTATGATCCACACAGAGTGGGAAGGATAACTGTTGAATTACAAGGCAG GGTTACTGATTGTCGAGCTCTTACTTACAGGCAAGACATTAAGGCAAAGGATATAGAAGCTTACAGATTGCGGAACCTTCCTACACGGCAGTGGGGTTAT GTTGTGGTCACAACTCCGGATGGTATATTGGATCACGAAGAGGCTATCAGTCGGAATGTGGGAGGTCAGGTTCTTGGTTATTTTCATTAG
AA sequence Show only first row Show all	>Potri.009G071250.1 pacid=42771670 polypeptide=Potri.009G071250.1.p locus=Potri.009G071250 ID=Potri.009G071250.1.v4.1 annot-version=v4.1 MGRRILNDALRAIVNAERRSKSTVELQPISTVTSSFLKIMKDRGYIKNFHVYDPHRVGRITVELQGRVTDCRALTYRQDIKAKDIEAYRLRNLPTRQWGY VVVTTPDGILDHEEAISRNVGGQVLGYFH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Potri.009G071250 [exp]	0	1
AT4G36130			Ribosomal protein L2 family (....		Potri.007G013000 [exp]	3.46	0.8452
AT5G39850			Ribosomal protein S4 (.1)		Potri.006G209700 [exp]	4.89	0.8226
AT3G21820		SDG36, ATXR2	SET DOMAIN PROTEIN 36, histone...		Potri.017G038700 [exp]	6.70	0.7658	SDG943
AT4G14320			Zinc-binding ribosomal protein...		Potri.010G251500 [exp]	7.34	0.7912
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.010G245400 [exp]	12.24	0.7965	Pt-RPS28.1
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Potri.001G391400 [exp]	12.32	0.7783	Pt-IE.1
AT1G68760		ATNUDX1, ATNUDT...	NUDIX HYDROLASE 1, ARABIDOPSIS...		Potri.008G114300 [exp]	13.41	0.7478
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Potri.005G162600 [exp]	15.19	0.7851
AT3G13580			Ribosomal protein L30/L7 famil...		Potri.008G008000 [exp]	15.55	0.7636	RPL7.3
AT5G28060			Ribosomal protein S24e family ...		Potri.005G049400 [exp]	15.81	0.7649	Pt-RPS24.1

Compare expression of checked genes

Potri.009G071250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.