Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68180 38 / 0.0003 RING/U-box superfamily protein (.1) AT1G55530 38 / 0.0004 RING/U-box superfamily protein (.1) AT2G40830 37 / 0.0007 RHC1A RING-H2 finger C1A (.1.2.3) AT3G10815 37 / 0.0008 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G243300 [exp] 40 / 9e-05 AT3G46620 239 / 8e-76 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.019G032500 [exp] 39 / 0.0001 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1) Potri.009G034800 [exp] 39 / 0.0002 AT3G46620 236 / 8e-75 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.003G223200 [exp] 38 / 0.0003 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1) Potri.013G060500 [exp] 37 / 0.0006 AT1G55530 207 / 2e-64 RING/U-box superfamily protein (.1) Potri.001G001500 [exp] 37 / 0.0007 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1) Potri.006G032100 [exp] 37 / 0.0007 AT2G40830 327 / 1e-111 RING-H2 finger C1A (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022967 [exp] 40 / 9e-05 AT1G60360 153 / 3e-45 RING/U-box superfamily protein (.1) Lus10001611 [exp] 39 / 0.0002 AT1G68180 156 / 2e-46 RING/U-box superfamily protein (.1) Lus10015046 [exp] 39 / 0.0004 AT5G02750 206 / 5e-65 SHOOT GRAVITROPISM 9, RING/U-box superfamily protein (.1) Lus10020258 [exp] 38 / 0.0005 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3) Lus10002637 [exp] 37 / 0.0008 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1) Lus10013397 [exp] 37 / 0.0009 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G071750.1 pacid=42770724 polypeptide=Potri.009G071750.1.p locus=Potri.009G071750 ID=Potri.009G071750.1.v4.1 annot-version=v4.1 ATGGAGGAGCTTCAAATTGCCATAGCAGAAGCTGAGGTTCTTAACAGGGCGAGCAACTGGGGCTATTACTCTACATTCGATGGCGCTTATGACCCTAGAG GTCACAATGGAAAGCTTGACGAAGAGGAACTACAATTTGCAAAGGTTCAGCTTGCGGGGATCATTTCGGCGAAAACTATTGATCCGGTGCTTGCTGGATT GAAGAATTTGGTGATTGATGGAGGTGGGGTTTGTCAAGAAGAGCTGGAGATTGGAGAGGAAGCTAGGGTCATGGAATGCATGCATGAATTTCATTGTTCT TGCATTTAA
AA sequence Show only first row Show all	>Potri.009G071750.1 pacid=42770724 polypeptide=Potri.009G071750.1.p locus=Potri.009G071750 ID=Potri.009G071750.1.v4.1 annot-version=v4.1 MEELQIAIAEAEVLNRASNWGYYSTFDGAYDPRGHNGKLDEEELQFAKVQLAGIISAKTIDPVLAGLKNLVIDGGGVCQEELEIGEEARVMECMHEFHCS CI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.009G071750 [exp]	0	1
					Potri.001G073350 [exp]	1.00	0.9864
AT4G33870			Peroxidase superfamily protein...		Potri.001G182400 [exp]	2.82	0.9826
AT5G24270		ATSOS3, CBL4, S...	CALCINEURIN B-LIKE PROTEIN 4, ...		Potri.015G013200 [exp]	5.47	0.9806
					Potri.010G199150 [exp]	6.63	0.9796
AT3G17380			TRAF-like family protein (.1)		Potri.008G199400 [exp]	7.41	0.9790
AT1G69120	MADS	AGL7, AP1	APETALA1, AGAMOUS-like 7, K-bo...		Potri.010G154100 [exp]	8.48	0.9710	Pt-AGL8.2
					Potri.006G216950 [exp]	9.16	0.9785
AT3G30387			Protein of unknown function (D...		Potri.004G110681 [exp]	9.48	0.9769
AT3G11980		FAR2, MS2	MALE STERILITY 2, FATTY ACID R...		Potri.016G062200 [exp]	10.53	0.9203	Pt-MS2.2
					Potri.005G011350 [exp]	12.40	0.9484

Compare expression of checked genes

Potri.009G071750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.