Plant FIBer expression Database

Potri.009G072000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G14190 105 / 2e-28 unknown protein
AT5G12360 100 / 9e-27 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G101600
[exp]
44 / 2e-05 ND /
Potri.017G113501
[exp]
43 / 4e-05 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003273
[exp]
52 / 5e-08 ND 42 / 8e-05
Lus10039048
[exp]
45 / 1e-05 AT5G12360 42 / 1e-04 unknown protein
Lus10038810
[exp]
45 / 1e-05 AT5G12360 43 / 5e-05 unknown protein
Lus10006544
[exp]
45 / 2e-05 AT3G59110 205 / 1e-57 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.009G072000.3 pacid=42771825 polypeptide=Potri.009G072000.3.p locus=Potri.009G072000 ID=Potri.009G072000.3.v4.1 annot-version=v4.1
ATGGCTACCCGTGTAACGCAGACGCCCCTGATAATCCAGGATGAGAATTTGGGTGTCAGTCGCAAAAAGGCTGGTTTTGATGGAAGTGTTAAGCAATCTA
AAACAGCGACGAAAAAAAGTGGGGGATTTGCGTTGGGAAATCGAAAGGCGCTCAATGATATTACAAACAAAGCAGTTGTTCGTCAAGAAACATCTTCTCG
GAAAAAGAATGTGCAAAAGGAAGAGATCAATAATGTAGCCGAGGAAAGATTTTTGCATGATCACAATAAATGCATTGAGGAAAAAGAGGCTACATCGATT
TCTTCTTTCCTGGACTTGGTCCTTCCTGGGCATGATTCAGTATCATCTACTGCTGAAAATCCCGAGGTTAAGCAGGTGAAGACTGATCCTGGTAGCTGCT
TCTATCCGGAACCGAAAGAATTGGCCATACCTGTGTTTTCTGATTGGTTTGAGTCTCCAACTCAGTGGCACTCTCCTCCATGCTCTCCTATTCACTGGGA
CTCTCCACCATGCTCTCCTTTTTCATGGCAATTTGAAGCTGTTGAATATGTGCTGAGGCCAGAAAGTGATGTTTGA
AA sequence
>Potri.009G072000.3 pacid=42771825 polypeptide=Potri.009G072000.3.p locus=Potri.009G072000 ID=Potri.009G072000.3.v4.1 annot-version=v4.1
MATRVTQTPLIIQDENLGVSRKKAGFDGSVKQSKTATKKSGGFALGNRKALNDITNKAVVRQETSSRKKNVQKEEINNVAEERFLHDHNKCIEEKEATSI
SSFLDLVLPGHDSVSSTAENPEVKQVKTDPGSCFYPEPKELAIPVFSDWFESPTQWHSPPCSPIHWDSPPCSPFSWQFEAVEYVLRPESDV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G14190 unknown protein Potri.009G072000
[exp]
0 1
AT1G21690 RFC4, EMB1968 replication factor C 4, embryo... Potri.005G181300
[exp]
1.00 0.7914
AT4G16830 Hyaluronan / mRNA binding fami... Potri.014G049300
[exp]
8.77 0.6835
AT2G33840 Tyrosyl-tRNA synthetase, class... Potri.010G248900
[exp]
14.83 0.7078
AT1G77470 EMB2810, RFC5, ... replication factor C 5, EMBRYO... Potri.002G081200
[exp]
14.96 0.7700
AT5G02560 HTA12 histone H2A 12 (.1.2) Potri.006G082300
[exp]
19.18 0.7103
AT5G59970 Histone superfamily protein (.... Potri.007G013300
[exp]
20.44 0.6535
AT4G17620 glycine-rich protein (.1.2.3) Potri.001G149900
[exp]
22.04 0.7198
AT3G04480 endoribonucleases (.1) Potri.019G019600
[exp]
23.55 0.6759
AT4G26300 EMB1027 embryo defective 1027, Arginyl... Potri.002G198500
[exp]
33.24 0.6778
AT3G27060 ATTSO2, TSO2 TSO MEANING 'UGLY' IN CHINESE ... Potri.001G329700
[exp]
36.12 0.6841

Potri.009G072000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.