Potri.009G074300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51780 196 / 4e-62 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G52060 160 / 3e-47 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G07220 150 / 5e-44 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT5G62100 147 / 1e-42 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G14360 123 / 5e-35 Ubiquitin-like superfamily protein (.1)
AT5G40630 110 / 1e-29 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G279500 410 / 3e-146 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.016G121200 186 / 4e-58 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
Potri.015G135500 174 / 2e-52 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 172 / 2e-51 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 162 / 8e-49 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.003G121500 156 / 4e-46 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.001G110300 150 / 4e-43 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.001G339100 131 / 6e-38 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027822 219 / 2e-70 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10005051 215 / 1e-67 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027420 172 / 1e-51 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10023279 162 / 2e-49 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10038882 160 / 3e-47 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 157 / 3e-46 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10003393 153 / 2e-45 AT3G51780 180 / 5e-56 BCL-2-associated athanogene 4 (.1)
Lus10005772 149 / 4e-43 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10029598 130 / 2e-36 AT5G52060 195 / 8e-61 BCL-2-associated athanogene 1 (.1)
Lus10006328 130 / 2e-36 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 PF02179 BAG BAG domain
Representative CDS sequence
>Potri.009G074300.1 pacid=42772472 polypeptide=Potri.009G074300.1.p locus=Potri.009G074300 ID=Potri.009G074300.1.v4.1 annot-version=v4.1
ATGAAAAGCTCAACTTCAAAAGGTACAGAGACAAGGGAGTTTAACTACAGGGAGATAGACTGGGAACTTAGGCCTGGTGGCATGCTTGTTCAAAAGAGAG
ATGTTGGGGTTGGCTCTTCTGGGCCTATGATCAAGATCAAGGTCTCTCATGGCTCATGTCACTATGATACTGATGTCCCTGCTCAATCCACTTTTGGGGA
TTTGAAAAAGGTTCTTGCCAATGAGACTGGCTTGGAGCCTCAAGAGCAGAGATTATTGTTTAGAGGCAAAGAAAGGGAGAATGATGAATATTTGCACATG
GTAGGTGTAAAAGACATGTCAAAGGTGATACTTTTTGAGGATCCAGCTAGCAAAGAGAGGAAGCTCGAGGAGATGAAGAGAAATCAGGGTACGTTTGAAG
CCTGTGAAGCTGTTGCCAGAGTGAGGGCAGAGGTTGATAAACTTTGCGAGAAGGTTGTTGCATTGGAGACAACATTTTGCAGTGGCACTGCGATTGCAGA
CAAAGAATTTGTTGTCTTGACAGAATTGCTTATGATACAGTTGCTTAAACTGGATTCAATTGAGGCTAATGGAGAAGCAAAGGTGCAGAGAAGGATTGAG
GTTCGTCGAATCCAGAGCTTTGTGGACACTCTTGACAATTTGAAAGTACGAAACTCTAACCCCTTCAGCAATAGTAGCAGTGCAGTATCAGTGACTACCA
AATGGGAGACATTTGCGTCTGGAGTTGGAAGCCTGAGTGCCCCAGTTCCAATACAATCTGCCACTAAAGTAACTCAGGACTGGGAGCTGTTTGACTAA
AA sequence
>Potri.009G074300.1 pacid=42772472 polypeptide=Potri.009G074300.1.p locus=Potri.009G074300 ID=Potri.009G074300.1.v4.1 annot-version=v4.1
MKSSTSKGTETREFNYREIDWELRPGGMLVQKRDVGVGSSGPMIKIKVSHGSCHYDTDVPAQSTFGDLKKVLANETGLEPQEQRLLFRGKERENDEYLHM
VGVKDMSKVILFEDPASKERKLEEMKRNQGTFEACEAVARVRAEVDKLCEKVVALETTFCSGTAIADKEFVVLTELLMIQLLKLDSIEANGEAKVQRRIE
VRRIQSFVDTLDNLKVRNSNPFSNSSSAVSVTTKWETFASGVGSLSAPVPIQSATKVTQDWELFD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G51780 ATBAG4 BCL-2-associated athanogene 4 ... Potri.009G074300 0 1
AT2G32720 B5 #4, B5#4, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Potri.002G242500 1.41 0.9427
AT5G24760 GroES-like zinc-binding dehydr... Potri.004G067000 2.00 0.9218
AT2G21940 ATSK1 shikimate kinase 1 (.1.2.3.4.5... Potri.007G081000 3.74 0.9115 SK3
AT4G01850 AtSAM2, SAM-2, ... S-adenosylmethionine synthetas... Potri.014G114700 4.00 0.9277 Pt-SAM1.1
AT1G55530 RING/U-box superfamily protein... Potri.013G060500 5.09 0.9017
AT2G33120 ATVAMP722, SAR1 ARABIDOPSIS THALIANA VESICLE-A... Potri.012G119600 6.00 0.9018
AT1G30900 VSR6, VSR3;3, B... VACUOLAR SORTING RECEPTOR 3;3,... Potri.003G155200 6.32 0.9216
AT5G07250 ATRBL3 RHOMBOID-like protein 3 (.1.2) Potri.015G142000 7.34 0.9121
AT2G40410 Staphylococcal nuclease homolo... Potri.008G074800 7.48 0.8774
AT2G40540 ATKUP2, ATKT2, ... potassium transporter 2 (.1.2) Potri.013G083400 7.48 0.9067 Pt-KT2.2

Potri.009G074300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.