Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07050 119 / 3e-34 CCT motif family protein (.1) AT5G14370 88 / 6e-21 CCT motif family protein (.1) AT5G57180 84 / 2e-19 CIA2 chloroplast import apparatus 2 (.1.2.3) AT4G25990 83 / 7e-19 CIL CCT motif family protein (.1.2) AT1G73870 73 / 3e-15 CO COL7 B-box type zinc finger protein with CCT domain (.1) AT1G25440 70 / 3e-14 CO COL16 B-box type zinc finger protein with CCT domain (.1) AT1G49130 69 / 5e-14 CO COL8 B-box type zinc finger protein with CCT domain (.1.2) AT1G68520 66 / 7e-13 CO COL6 B-box type zinc finger protein with CCT domain (.1) AT2G24790 52 / 2e-08 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2) AT5G15840 52 / 6e-08 CO FG, CO CONSTANS, B-box type zinc finger protein with CCT domain (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G281700 [exp] 247 / 4e-84 AT1G07050 138 / 8e-41 CCT motif family protein (.1) Potri.018G142100 [exp] 90 / 2e-21 AT5G57180 160 / 5e-44 chloroplast import apparatus 2 (.1.2.3) Potri.006G075200 [exp] 86 / 1e-19 AT5G57180 267 / 5e-85 chloroplast import apparatus 2 (.1.2.3) Potri.001G339200 [exp] 84 / 1e-19 AT5G14370 174 / 5e-52 CCT motif family protein (.1) Potri.015G054600 [exp] 73 / 2e-15 AT1G25440 272 / 2e-87 B-box type zinc finger protein with CCT domain (.1) Potri.010G125100 [exp] 70 / 4e-14 AT1G25440 311 / 3e-102 B-box type zinc finger protein with CCT domain (.1) Potri.008G120400 [exp] 69 / 6e-14 AT1G25440 314 / 2e-103 B-box type zinc finger protein with CCT domain (.1) Potri.014G134601 [exp] 54 / 9e-09 AT2G47890 174 / 4e-53 B-box type zinc finger protein with CCT domain (.1.2) Potri.007G121200 [exp] 50 / 1e-07 AT3G21880 291 / 1e-95 B-box type zinc finger protein with CCT domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014886 [exp] 69 / 9e-14 AT5G14370 152 / 3e-42 CCT motif family protein (.1) Lus10022311 [exp] 68 / 1e-13 AT5G14370 141 / 1e-38 CCT motif family protein (.1) Lus10020012 [exp] 63 / 1e-11 AT5G57180 211 / 2e-60 chloroplast import apparatus 2 (.1.2.3) Lus10041449 [exp] 56 / 3e-09 AT1G25440 288 / 4e-93 B-box type zinc finger protein with CCT domain (.1) Lus10026238 [exp] 52 / 5e-08 AT5G24930 163 / 9e-48 CONSTANS-like 4 (.1) Lus10042431 [exp] 50 / 2e-07 AT5G24930 180 / 7e-55 CONSTANS-like 4 (.1) Lus10026909 [exp] 50 / 3e-07 AT5G24930 404 / 3e-140 CONSTANS-like 4 (.1) Lus10020105 [exp] 50 / 3e-07 AT5G24930 398 / 6e-138 CONSTANS-like 4 (.1) Lus10036419 [exp] 47 / 2e-06 AT5G48250 332 / 8e-112 B-box type zinc finger protein with CCT domain (.1) Lus10041096 [exp] 47 / 2e-06 AT5G48250 374 / 2e-129 B-box type zinc finger protein with CCT domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0281 [poplar] [flax] CCT PF06203 [poplar] [flax] CCT CCT motif
Representative CDS sequence Show only first row Show all	>Potri.009G077100.2 pacid=42770782 polypeptide=Potri.009G077100.2.p locus=Potri.009G077100 ID=Potri.009G077100.2.v4.1 annot-version=v4.1 ATGAAATTGGAAGGGATTTTGGGAATTGAAGATGATGAAAGGTTGTCAAGTGATAACATGTATGGTCTAGTTGGTTGGGATTTTATGGACTCAGAGGAGT ATCCAACTGTTGAAGATGAAGAAGGATCAGAAATGTTTAGGTTTGATGATAGCAGAAGCAGTTTCTTTGAGTTTGAAGACAGCCATTATAGTACTGGTAA GGTTATAAAGGAAGAGAGTCTTGGATTTTGGGATGGAGATGAGAAGAGAGTGTCTTTGAACTTGAACTTGAATTATCAAGAGGTCTTGGATGCATGGTCT GATCGTGGGTCACTTTTGGCCGATGATTACTCTCTTTCCATGGAAAGCACTTGCTATTATAAGGGAGAGGTGCCGGTGATGGAAGAAGATAGGACAAGAA GGGAAGCGAGTGTGCTTAGATACAAAGAGAAGCGCCAGACTAGACTGTTCTCTAAGAAGATAAGATATCCAGTATCAATTCGCAAACTCAATGCTGATAA AAGTTCCAGACTCAAGGGTCGATTTGTGAAGAGAGTTTTCTAA
AA sequence Show only first row Show all	>Potri.009G077100.2 pacid=42770782 polypeptide=Potri.009G077100.2.p locus=Potri.009G077100 ID=Potri.009G077100.2.v4.1 annot-version=v4.1 MKLEGILGIEDDERLSSDNMYGLVGWDFMDSEEYPTVEDEEGSEMFRFDDSRSSFFEFEDSHYSTGKVIKEESLGFWDGDEKRVSLNLNLNYQEVLDAWS DRGSLLADDYSLSMESTCYYKGEVPVMEEDRTRREASVLRYKEKRQTRLFSKKIRYPVSIRKLNADKSSRLKGRFVKRVF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07050			CCT motif family protein (.1)		Potri.009G077100 [exp]	0	1
AT2G25737			Sulfite exporter TauE/SafE fam...		Potri.001G183300 [exp]	4.58	0.8210
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.011G137950 [exp]	9.16	0.7217
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Potri.012G133800 [exp]	13.78	0.6424	Pt-ARR13.1,PtRR17
					Potri.018G064450 [exp]	15.74	0.6809
AT5G18470			Curculin-like (mannose-binding...		Potri.013G050500 [exp]	18.24	0.8464
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Potri.019G094100 [exp]	19.33	0.8083
AT4G30880			Bifunctional inhibitor/lipid-t...		Potri.001G023200 [exp]	19.77	0.7784
					Potri.010G058050 [exp]	21.44	0.7784
AT1G74220			unknown protein		Potri.015G057200 [exp]	23.95	0.7987
					Potri.019G126901 [exp]	23.97	0.7784

Compare expression of checked genes

Potri.009G077100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.