Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14520 592 / 0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G33700 579 / 0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT1G47330 402 / 1e-136 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT5G52790 365 / 9e-123 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14230 347 / 2e-115 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14240 346 / 4e-115 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) AT1G03270 339 / 2e-112 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT3G13070 53 / 2e-07 CBS domain-containing protein / transporter associated domain-containing protein (.1) AT1G55930 53 / 3e-07 CBS domain-containing protein / transporter associated domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G288000 [exp] 699 / 0 AT2G14520 620 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G012400 [exp] 506 / 6e-179 AT2G14520 516 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G196900 [exp] 400 / 2e-135 AT1G47330 575 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.017G147900 [exp] 398 / 5e-135 AT5G52790 580 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.008G202100 [exp] 374 / 4e-126 AT4G14240 632 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) Potri.010G030200 [exp] 368 / 1e-123 AT4G14240 611 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) Potri.002G260401 [exp] 57 / 3e-10 AT1G47330 58 / 3e-11 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.001G362100 [exp] 52 / 4e-07 AT1G55930 858 / 0.0 CBS domain-containing protein / transporter associated domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005259 [exp] 608 / 0 AT2G14520 679 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012476 [exp] 523 / 0 AT2G14520 591 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10020494 [exp] 477 / 2e-168 AT2G14520 538 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10030665 [exp] 427 / 7e-150 AT2G14520 498 / 3e-178 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10027528 [exp] 397 / 4e-135 AT5G52790 560 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10039289 [exp] 396 / 9e-135 AT5G52790 557 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10032715 [exp] 396 / 1e-134 AT1G47330 646 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10034024 [exp] 370 / 9e-125 AT4G14230 675 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012375 [exp] 369 / 2e-124 AT1G03270 627 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10028010 [exp] 364 / 4e-122 AT1G03270 635 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01595 [poplar] [flax] DUF21 Cyclin M transmembrane N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.009G082300.1 pacid=42772183 polypeptide=Potri.009G082300.1.p locus=Potri.009G082300 ID=Potri.009G082300.1.v4.1 annot-version=v4.1 ATGGCGGTGGAGTATAAGTGCTGCGAAACGGATTTCTTTGTAAACATTGTGATAATAGTTTTGCTCGTGTTGTTCGCTGGACTGATGTCTGGCCTTACTC TGGGCCTTATGTCTATGAGTATCGTCGATCTTGAAGTTCTTGCTAAATCCGGTACTCCAAAAAATCGAAAATACGCAGCGAAAATATTGCCAGTGGTTAA AAACCAGCATTTGTTGCTTTGCACGCTCCTTATATGCAACGCTACTGCTATGGAGGCACTTCCAATTTTTCTTGATAGTCTGGTTACAGCTGGGGTTGCT ATTGTAATTTCAGTAACTCTGATTCTTCTATTTGGCGAGATTTTACCACAATCTGTTTGTTCCCGATATGGTTTGGCAATTGGTGCAACAGTGGCCCCGT TTGTCCGTCTTCTAGTTTGGATCTGTTTTCCTGTTGCCTATCCGATAAGCAAGCTCCTGGACTTTCTGCTGGGACATGGTCATGTTGCTCTTTTTCGCAG AGCTGAGTTGAAAACACTTGTAAATTTTCATGGTAACGAGGCTGGAAAAGGTGGAGAACTAACTCATGATGAGACAACAATAATTGCTGGAGCACTTGAG CTCACTGAGAAAACAGCTAGTGATGCCATGACCCCTATATCTGAAACTTTTGCTATTGACATTAATGACAAACTTGACAGGGAGTTGATGAGTTTGATAT TGGAGAAAGGGCATAGCAGAGTGCCAGTTTATTATGAGCAACCTACAAACATAATTGGACTAATTCTGGCCAATAATTTGTTGACAATTCACCCAGAAGA TAAAGTACCTGTAAAGAATGTCACTATACGCAGGATTCCCAGGGTTCCAGAAACTTTGCCTTTATATGATATATTGAATGAGTTTCAGAAAGGTCATAGC CACATGGCAGTTGTTACAAGGCAGTGTAAAAAGCCAGAGGAGCAGCCTATAAGCAATGCTGGTGACAATCCGGTGAAAGAAGTTAAAGTTAATATTGATG GTGAAAGGCCTCCCAAGGACAAGGCTTTGAAGAGCAAGAGACCACTTCAAAAGTGGAAAAGCTTTCCCAAGAGTGGCAACAATTCATTTAGAGGCTCAAG GAGCAAGAAGTGGACAGAGGACATGAACTCAAACATCTTGCACATAAATGGCAATCCACTCCCAAGGCTTCCTGAGGAAGAAGAAGCAATTGGCATAATA ACAATGGAAGATGTCATTGAAGAGCTTTTACAGGAGGAGATCTTTGATGAGACAGATCATCGTTTTGAGGGACACTGCCTAGGTGAGCTGTAG
AA sequence Show only first row Show all	>Potri.009G082300.1 pacid=42772183 polypeptide=Potri.009G082300.1.p locus=Potri.009G082300 ID=Potri.009G082300.1.v4.1 annot-version=v4.1 MAVEYKCCETDFFVNIVIIVLLVLFAGLMSGLTLGLMSMSIVDLEVLAKSGTPKNRKYAAKILPVVKNQHLLLCTLLICNATAMEALPIFLDSLVTAGVA IVISVTLILLFGEILPQSVCSRYGLAIGATVAPFVRLLVWICFPVAYPISKLLDFLLGHGHVALFRRAELKTLVNFHGNEAGKGGELTHDETTIIAGALE LTEKTASDAMTPISETFAIDINDKLDRELMSLILEKGHSRVPVYYEQPTNIIGLILANNLLTIHPEDKVPVKNVTIRRIPRVPETLPLYDILNEFQKGHS HMAVVTRQCKKPEEQPISNAGDNPVKEVKVNIDGERPPKDKALKSKRPLQKWKSFPKSGNNSFRGSRSKKWTEDMNSNILHINGNPLPRLPEEEEAIGII TMEDVIEELLQEEIFDETDHRFEGHCLGEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14520			CBS domain-containing protein ...		Potri.009G082300 [exp]	0	1
AT5G33280			Voltage-gated chloride channel...		Potri.006G064000 [exp]	1.00	0.8648
AT2G26980		CIPK3, SnRK3.17	SNF1-RELATED PROTEIN KINASE 3....		Potri.001G222600 [exp]	3.00	0.7994	Pt-CIPK3.1
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Potri.017G101700 [exp]	4.58	0.7998
AT5G35560			DENN (AEX-3) domain-containing...		Potri.006G143000 [exp]	9.38	0.8210
AT4G34260		AXY8, FUC95A	ALTERED XYLOGLUCAN 8, 1,2-alph...		Potri.001G299000 [exp]	10.39	0.7672
AT5G59080			unknown protein		Potri.009G038300 [exp]	11.40	0.7938
AT4G39850		AtABCD1, ACN2, ...	PEROXISOME DEFECTIVE 3, COMATO...		Potri.007G092200 [exp]	15.74	0.7995
AT1G06290		ATACX3, ACX3	acyl-CoA oxidase 3 (.1)		Potri.013G123500 [exp]	17.00	0.7760
AT3G19740			P-loop containing nucleoside t...		Potri.005G093300 [exp]	18.00	0.8043
AT1G35710			Protein kinase family protein ...		Potri.019G122500 [exp]	20.19	0.7611

Compare expression of checked genes

Potri.009G082300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.