Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 203 / 9e-68 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT4G33720 200 / 1e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 191 / 4e-63 ATPRB1 basic pathogenesis-related protein 1 (.1) AT3G19690 185 / 1e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 181 / 4e-59 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G50060 167 / 8e-54 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33710 165 / 7e-53 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 162 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 150 / 2e-46 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 149 / 2e-46 PR-1-LIKE pathogenesis-related protein-1-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083100 [exp] 312 / 6e-111 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 290 / 2e-102 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 277 / 1e-96 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 214 / 4e-72 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.001G288600 [exp] 213 / 2e-71 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288401 [exp] 208 / 9e-70 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 196 / 5e-65 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082800 [exp] 173 / 4e-56 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.018G096007 [exp] 157 / 1e-49 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012479 [exp] 197 / 2e-65 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 196 / 4e-65 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 196 / 5e-65 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10025697 [exp] 184 / 3e-60 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10007102 [exp] 173 / 1e-55 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 169 / 8e-54 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 163 / 1e-51 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10012478 [exp] 160 / 2e-50 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10020492 [exp] 149 / 6e-47 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1) Lus10013693 [exp] 150 / 7e-47 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [poplar] [flax] CAP PF00188 [poplar] [flax] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Potri.009G083300.1 pacid=42770758 polypeptide=Potri.009G083300.1.p locus=Potri.009G083300 ID=Potri.009G083300.1.v4.1 annot-version=v4.1 ATGATGTCAAGCAAGATTTCTCTTGCTTTCTTTACTCTTATAACCTTATCCCTAATCCTTCCCTCTCGTGCCCAAGACAACCCACAAGATTACCTTGATG CTCATAATGCAGCTCGTGCAGCTGTAGGTGTTGGTCCACTAACCTGGGACACCACAGTGCAAGCCTATGCACAAAATTATGCTAACCAACGTGCCGGCGA TTGCAACCTTATCCATTCAGGTGGACCTTATGGGGAGAACCTTGCATGGAGCAGCGCGGACCTTTCAGGTACAGATGCTGTCAAAATGTGGGTTGATGAG AAGGCTTACTACGACTACAACTCCAACTCATGTGCCGCTGGCCAGCAGTGTGGGCACTATACTCAGGTGGTTTGGCGGAACTCTGCTCGCCTAGGATGTG CTAAAGTGAAGTGTAGCACCGGAGGAACCTTCATTGGGTGCAACTATGATCCACCCGGCAACTATGTTGGGCAAAAACCTTACTAA
AA sequence Show only first row Show all	>Potri.009G083300.1 pacid=42770758 polypeptide=Potri.009G083300.1.p locus=Potri.009G083300 ID=Potri.009G083300.1.v4.1 annot-version=v4.1 MMSSKISLAFFTLITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLIHSGGPYGENLAWSSADLSGTDAVKMWVDE KAYYDYNSNSCAAGQQCGHYTQVVWRNSARLGCAKVKCSTGGTFIGCNYDPPGNYVGQKPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Potri.009G083300 [exp]	0	1
AT3G46400			Leucine-rich repeat protein ki...		Potri.012G002900 [exp]	3.87	0.8850
AT2G17040	NAC	ANAC036	NAC domain containing protein ...		Potri.005G103200 [exp]	5.74	0.8804
AT2G22240		ATIPS2, ATMIPS2	MYO-INOSITOL-1-PHOSTPATE SYNTH...		Potri.007G089000 [exp]	6.63	0.8836	Pt-MIPS.2
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G023900 [exp]	21.77	0.8733	CHI3.7
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Potri.018G098200 [exp]	24.73	0.8170
AT2G17500			Auxin efflux carrier family pr...		Potri.005G099300 [exp]	32.18	0.8342
AT5G24090		ATCHIA	chitinase A (.1)		Potri.012G033899 [exp]	32.98	0.8767
AT4G24730			Calcineurin-like metallo-phosp...		Potri.012G089400 [exp]	48.92	0.8012
AT5G64810	WRKY	ATWRKY51, WRKY5...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.005G085200 [exp]	68.62	0.7986	WRKY51.1
					Potri.019G110602 [exp]	95.26	0.7786

Compare expression of checked genes

Potri.009G083300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.