Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14620 454 / 1e-162 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1) AT4G37800 292 / 6e-99 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1) AT5G65730 290 / 6e-98 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1) AT3G23730 288 / 2e-97 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G30270 285 / 1e-96 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT5G57550 283 / 3e-95 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G57530 275 / 2e-92 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G57560 275 / 2e-92 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G13870 274 / 1e-91 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) AT2G18800 271 / 3e-90 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G140300 [exp] 291 / 2e-98 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.003G159700 [exp] 290 / 4e-98 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.011G077320 [exp] 290 / 5e-98 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.007G008500 [exp] 290 / 6e-98 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1) Potri.014G146100 [exp] 288 / 3e-97 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.006G170001 [exp] 285 / 2e-96 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G169900 [exp] 285 / 2e-96 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G170100 [exp] 285 / 2e-96 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 283 / 2e-95 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035654 [exp] 471 / 1e-169 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1) Lus10011112 [exp] 297 / 1e-100 AT4G28850 365 / 1e-127 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10011597 [exp] 291 / 1e-98 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1) Lus10039643 [exp] 291 / 1e-98 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1) Lus10012978 [exp] 287 / 6e-97 AT4G28850 359 / 3e-125 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10040121 [exp] 280 / 3e-94 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10011052 [exp] 281 / 4e-94 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10030923 [exp] 280 / 4e-94 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10031393 [exp] 280 / 5e-94 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10000678 [exp] 279 / 6e-94 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.009G083800.1 pacid=42772873 polypeptide=Potri.009G083800.1.p locus=Potri.009G083800 ID=Potri.009G083800.1.v4.1 annot-version=v4.1 ATGTCTACTACTTTCAAATTCGTAGTCTTCATTGGACTTCTCATCACAAATACTTTTCAAGTATCATTTTCCTCTGTTATTTCAACCGGAGATTTCAACA AGGACTTCTCTGTAGCATGGTCTCCGAGCCATGTATACACCACTGCTAATGGCAGGACAAGAAGCTTGAAACTAGACCAAGAATCTGGATCTGGTTTTGC TTCGAACCAGATGTTCTTATTCGGGCAGATTGATATGCAAATAAAATTAGTACCAGGTCATTCAGCAGGCACAGTCGTGGCATTTTATCTATCATCGGAT CAACCTAAACGTGACGAAATAGATTTTGAATTCCTTGGAAATGTGAGTGGCCAACCATATATTCTTCAAACAAATGTTTATGCTGATGGGAATGATGATC GTGAAGAGAGGATTTATCTCTGGTTTGATCCAACAAAAAACTTCCATACTTATTCGGTCTTGTGGAACCTTCACCAAATTGTGTTCATGGTGGATTGGAT TCCTATCAGACTTTACAGAAACCATGCAGACAAAGGTGTAGCATATCCTAGGTGGCAGCCAATGAGCATCAAAGCCAGCCTATGGAACGGCGACAGCTGG GCAACACGAGGCGGGAAAGACAAAATTGATTGGTCAAAGGGTCCCTTCATAGCTTCCTTCAGGAATTATAAGATCGATGCTTGTCCTTGGAATGGAAATC CAAGGTTTTGTAGGGCAGAAAGCTCTACTAATTGGTGGAACAAGGAAAGATATAGCACTTTAACATCTACACAAAGAAGGTGGTTCAAGTGGGTCAGGTT GCACCACATGATCTACGACTACTGTCAAGATAACAAGAGATTCCAAAATAACCTCCCAAAAGAATGTTCTCTTCCTAAATACTGA
AA sequence Show only first row Show all	>Potri.009G083800.1 pacid=42772873 polypeptide=Potri.009G083800.1.p locus=Potri.009G083800 ID=Potri.009G083800.1.v4.1 annot-version=v4.1 MSTTFKFVVFIGLLITNTFQVSFSSVISTGDFNKDFSVAWSPSHVYTTANGRTRSLKLDQESGSGFASNQMFLFGQIDMQIKLVPGHSAGTVVAFYLSSD QPKRDEIDFEFLGNVSGQPYILQTNVYADGNDDREERIYLWFDPTKNFHTYSVLWNLHQIVFMVDWIPIRLYRNHADKGVAYPRWQPMSIKASLWNGDSW ATRGGKDKIDWSKGPFIASFRNYKIDACPWNGNPRFCRAESSTNWWNKERYSTLTSTQRRWFKWVRLHHMIYDYCQDNKRFQNNLPKECSLPKY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14620		XTH10, XTR14	xyloglucan endotransglucosylas...		Potri.009G083800 [exp]	0	1
AT5G57670			Protein kinase superfamily pro...		Potri.006G173700 [exp]	1.00	0.8776
AT1G14185			Glucose-methanol-choline (GMC)...		Potri.010G168100 [exp]	4.24	0.8641
AT5G57670			Protein kinase superfamily pro...		Potri.018G096100 [exp]	7.48	0.8157
AT3G08490			unknown protein		Potri.009G061300 [exp]	9.16	0.8554
AT2G41830			Uncharacterized protein (.1)		Potri.006G052100 [exp]	10.24	0.8582
AT5G15900		TBL19	TRICHOME BIREFRINGENCE-LIKE 19...		Potri.017G110200 [exp]	10.48	0.8720
AT1G33470			RNA-binding (RRM/RBD/RNP motif...		Potri.019G068400 [exp]	12.96	0.8589
AT3G08490			unknown protein		Potri.001G267200 [exp]	15.87	0.8401
AT1G79620			Leucine-rich repeat protein ki...		Potri.006G114400 [exp]	21.42	0.8500
AT5G53760		ATMLO11, MLO11	MILDEW RESISTANCE LOCUS O 11, ...		Potri.001G402400 [exp]	21.90	0.8494	Pt-MLO11.1

Compare expression of checked genes

Potri.009G083800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.