Potri.009G084800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50020 177 / 6e-56 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G289400 314 / 1e-109 AT1G50020 207 / 5e-68 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012445 200 / 1e-60 AT3G22960 479 / 7e-163 PLASTIDIAL PYRUVATE KINASE 1, Pyruvate kinase family protein (.1)
Lus10033758 149 / 7e-45 AT1G50020 145 / 1e-43 unknown protein
PFAM info
Representative CDS sequence
>Potri.009G084800.2 pacid=42771136 polypeptide=Potri.009G084800.2.p locus=Potri.009G084800 ID=Potri.009G084800.2.v4.1 annot-version=v4.1
ATGGCTTCTCTACACATACTGAAATCAACTCTCTCCACCCTCTCCACTTCACCGTCAAAAGACTTCATCGGGAAATCAAATTACAGGAAAACAATTCCCA
AGTTGAGAACTTTTTATGGCAGCTCAAGAAGATATTCTGGGAGACAGCAAAAGGTTAAGGTTTTTTGTTCGGTCCAAGAAGAAGATAATAATCAAAGAAA
TGGGGAAGAGCCAACAGAGTCTTTGTTCATGAAGGAACTGAAGAGGAGGGGTATGACTCCAACTTCATTGCTTGAAGAGACTAATAGAGGCAATTATGGA
GTGGAAGATGAAATGAAAATAGGAGAGGAAGATAGGGGTTTCTCCAAAAGAAATCCAGTATCAACTGAACTTGATAAAAGTTTGTCTAATCAAAGGGAGA
AGTCAATGGCTCTTAATAGTGAAGGAATTGAGGGGTTAATTCCTAGGGCCAAGCTTTTGCTTACTCTTGGAGGAACTTTCTTCCTGGGATTTTGGCCATT
GATTCTCATAACTGTTGCATTTTTTTCCAGTCTCTACTTTTACTTTGGGCCAAGCTTCGTCCACGACGGAAGCAATGCATCATTCTCCCCACCACAATAT
ATTGATCCATATGAACTGCTGGAAGACGAAAGAATATCTCAAATAGCTCCTAGTTTAAAATGA
AA sequence
>Potri.009G084800.2 pacid=42771136 polypeptide=Potri.009G084800.2.p locus=Potri.009G084800 ID=Potri.009G084800.2.v4.1 annot-version=v4.1
MASLHILKSTLSTLSTSPSKDFIGKSNYRKTIPKLRTFYGSSRRYSGRQQKVKVFCSVQEEDNNQRNGEEPTESLFMKELKRRGMTPTSLLEETNRGNYG
VEDEMKIGEEDRGFSKRNPVSTELDKSLSNQREKSMALNSEGIEGLIPRAKLLLTLGGTFFLGFWPLILITVAFFSSLYFYFGPSFVHDGSNASFSPPQY
IDPYELLEDERISQIAPSLK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G50020 unknown protein Potri.009G084800 0 1
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Potri.001G258100 1.41 0.9750
AT3G21750 UGT71B1 UDP-glucosyl transferase 71B1 ... Potri.016G016900 3.46 0.9576
AT4G11570 Haloacid dehalogenase-like hyd... Potri.003G127100 4.24 0.9532
AT2G32540 ATCSLB4, ATCSLB... CELLULOSE SYNTHASE LIKE B4, ce... Potri.002G227300 5.47 0.9617 ATCSLB05.1
AT5G09830 BolA-like family protein (.1) Potri.001G309200 6.00 0.9460
AT4G35040 bZIP bZIP19 Basic-leucine zipper (bZIP) tr... Potri.009G134900 7.28 0.9245
AT1G23840 unknown protein Potri.006G262900 7.34 0.9336
AT5G49940 ATCNFU2, NFU2 CHLOROPLAST-LOCALIZED NIFU-LIK... Potri.003G009300 8.12 0.9462
AT4G25370 Double Clp-N motif protein (.1... Potri.012G129800 10.24 0.9589
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Potri.003G132400 12.24 0.9571

Potri.009G084800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.