Potri.009G086400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49975 82 / 2e-21 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G292000 100 / 9e-29 AT1G49975 154 / 2e-49 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006137 78 / 6e-20 AT1G49975 155 / 6e-50 unknown protein
Lus10033771 69 / 2e-16 AT1G49975 157 / 2e-50 unknown protein
PFAM info
Representative CDS sequence
>Potri.009G086400.4 pacid=42770835 polypeptide=Potri.009G086400.4.p locus=Potri.009G086400 ID=Potri.009G086400.4.v4.1 annot-version=v4.1
ATGACTTCAATATCCCAAAGCGTGTTGATGGCACTGACAGTTACAGTCAACAAGTTTGCTTCATCAAATGTTCATGCAGTGAATAAAAAAGAAGGTAAGA
GACCACCCAAAGCAGCAACAAGGGCAGCTGACATTGGAAGAAGAGGAGTCCTTTTATCTACCATGGTTGATGTGTTTTCAGTCAATGACTCAATTAGCAC
TGAGCTTCTTAAAAGATATTTGAAGAGATCAGAGGAAAACAAGGCCAAAAAATGA
AA sequence
>Potri.009G086400.4 pacid=42770835 polypeptide=Potri.009G086400.4.p locus=Potri.009G086400 ID=Potri.009G086400.4.v4.1 annot-version=v4.1
MTSISQSVLMALTVTVNKFASSNVHAVNKKEGKRPPKAATRAADIGRRGVLLSTMVDVFSVNDSISTELLKRYLKRSEENKAKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G49975 unknown protein Potri.009G086400 0 1
AT4G04330 AtRbcX1 homologue of cyanobacterial Rb... Potri.011G010300 2.00 0.9831
AT3G18870 Mitochondrial transcription te... Potri.004G150600 2.23 0.9843
AT1G76080 ATCDSP32, CDSP3... ARABIDOPSIS THALIANA CHLOROPLA... Potri.002G016401 5.65 0.9744
AT3G06950 Pseudouridine synthase family ... Potri.008G206200 9.79 0.9648
AT3G26630 Tetratricopeptide repeat (TPR)... Potri.002G220600 9.89 0.9673
AT2G01870 unknown protein Potri.001G257400 11.22 0.9726
AT3G54210 Ribosomal protein L17 family p... Potri.006G113500 11.40 0.9742
AT4G11175 Nucleic acid-binding, OB-fold-... Potri.018G038900 12.84 0.9699
AT1G23400 CAF2, ATCAF2 ARABIDOPSIS THALIANA HOMOLOG O... Potri.010G042500 13.03 0.9704
AT5G52960 unknown protein Potri.012G033700 13.41 0.9706

Potri.009G086400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.