Potri.009G086850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.009G086850.1 pacid=42770925 polypeptide=Potri.009G086850.1.p locus=Potri.009G086850 ID=Potri.009G086850.1.v4.1 annot-version=v4.1
ATGGGCGCAGGTGCTGAGGATCGCCGTCACTTTCAAATCACGGGATCCGGGACGGAAGGATCAGAAGGCGTAAGGGATTTCTTGCTTAAAAGACCAGCTG
TTTTGATGATGAATCGCGCAGGAAGTTTCTTTTCAGATTGTACGGTACAGTTCAGTTGA
AA sequence
>Potri.009G086850.1 pacid=42770925 polypeptide=Potri.009G086850.1.p locus=Potri.009G086850 ID=Potri.009G086850.1.v4.1 annot-version=v4.1
MGAGAEDRRHFQITGSGTEGSEGVRDFLLKRPAVLMMNRAGSFFSDCTVQFS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G086850 0 1
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.013G151366 4.89 0.9140
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Potri.013G151300 8.71 0.9094
AT4G34860 A/N-InvB alkaline/neutral invertase B, ... Potri.009G129000 9.79 0.7727
AT4G33140 Haloacid dehalogenase-like hyd... Potri.006G216500 9.89 0.8822
AT4G26288 unknown protein Potri.009G120300 10.72 0.8886
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.004G210600 10.95 0.9026
AT4G32285 ENTH/ANTH/VHS superfamily prot... Potri.006G066900 11.48 0.8918
AT3G19280 FUCTA, FUCT1, A... fucosyltransferase 11 (.1) Potri.009G101500 11.74 0.8861 FUCT3.2
AT3G25855 Copper transport protein famil... Potri.008G119200 16.85 0.7917
AT3G15810 Protein of unknown function (D... Potri.006G067000 21.33 0.8713

Potri.009G086850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.