Potri.009G086900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs

No hit found

Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12734 CYSTM Cysteine-rich TM module stress tolerance
Representative CDS sequence
>Potri.009G086900.1 pacid=42771986 polypeptide=Potri.009G086900.1.p locus=Potri.009G086900 ID=Potri.009G086900.1.v4.1 annot-version=v4.1
ATGAGTTACTACAACCAGCAACAGCCTCCTGTTGGTGTCCCGCCTCCTCAAGGTTATCCACCAGAAGGATATCCTAAGGACGCTTATCCACCACCAGGAT
ACCCACCGCAAGGGTATCCTCAAGGTTATCCACCACAAGGTTATCCACCACAAGGATATCCTCCTCCTCCACCCTATGCTCCTCAGTATGGCCAACCACC
CCGTCAACAACAGGGAAGTTCTGGGCCTGGTTGCATGGAAGGATGTTTGGCTGCTCTGTGCTGCTGCTGTCTCCTGGATGCCTGCTTTTGA
AA sequence
>Potri.009G086900.1 pacid=42771986 polypeptide=Potri.009G086900.1.p locus=Potri.009G086900 ID=Potri.009G086900.1.v4.1 annot-version=v4.1
MSYYNQQQPPVGVPPPQGYPPEGYPKDAYPPPGYPPQGYPQGYPPQGYPPQGYPPPPPYAPQYGQPPRQQQGSSGPGCMEGCLAALCCCCLLDACF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G086900 0 1
AT1G02130 ARA5, AtRABD2a,... ARABIDOPSIS THALIANA RAB D2A, ... Potri.003G081800 1.73 0.8019 RAB1.6
AT4G29210 GGT4, GGT3 gamma-glutamyl transpeptidase ... Potri.018G069450 4.00 0.7525
AT1G74320 Protein kinase superfamily pro... Potri.003G193000 4.24 0.7221
AT5G51400 PLAC8 family protein (.1) Potri.003G108800 4.89 0.7562
AT2G23140 RING/U-box superfamily protein... Potri.007G051000 5.47 0.6821
AT5G16880 Target of Myb protein 1 (.1.2.... Potri.019G050000 5.74 0.6921
AT3G02360 6-phosphogluconate dehydrogena... Potri.004G108920 6.70 0.7325
AT1G25682 Family of unknown function (DU... Potri.008G115700 10.81 0.6885
AT4G39140 RING/U-box superfamily protein... Potri.004G158400 14.07 0.6626
AT2G23070 Protein kinase superfamily pro... Potri.007G054100 18.65 0.6912

Potri.009G086900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.