Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33910 431 / 1e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G23096 306 / 5e-105 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 185 / 3e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G20270 185 / 4e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G28480 179 / 2e-54 Oxoglutarate/iron-dependent oxygenase (.1.2) AT3G28490 175 / 3e-53 Oxoglutarate/iron-dependent oxygenase (.1) AT2G17720 172 / 3e-52 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G35810 172 / 4e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G18900 162 / 2e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 160 / 2e-47 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G296800 [exp] 514 / 0 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G052600 [exp] 353 / 4e-123 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G245300 [exp] 181 / 1e-55 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G108000 [exp] 181 / 2e-55 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G075100 [exp] 180 / 7e-55 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.007G060800 [exp] 175 / 5e-53 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G075300 [exp] 172 / 3e-52 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.008G197700 [exp] 171 / 2e-51 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G232100 [exp] 152 / 2e-44 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011085 [exp] 218 / 5e-70 AT4G33910 241 / 4e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028404 [exp] 181 / 1e-55 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 180 / 3e-55 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10032183 [exp] 180 / 9e-55 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10012014 [exp] 170 / 5e-51 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016271 [exp] 168 / 3e-50 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014502 [exp] 167 / 7e-50 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10005620 [exp] 156 / 2e-45 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10031048 [exp] 149 / 1e-43 AT2G43080 406 / 7e-145 P4H isoform 1 (.1) Lus10017249 [exp] 142 / 9e-40 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF13640 [poplar] [flax] 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.009G091000.1 pacid=42770781 polypeptide=Potri.009G091000.1.p locus=Potri.009G091000 ID=Potri.009G091000.1.v4.1 annot-version=v4.1 ATGAAAATCAAAACGAAACGATCAAAAAGAAAACTGGGGTTACCAGCTGCAATTATTCTTTGTTCTTTGTTCTTTCTTGCCGGTTTCTACAGTTCCATTT TCTTCCCCCACGATGTACCTGTTACTAGACCGAGGTTAAGAATGCTTGAAGTAGCTGAAGGGGATCATGATACGATGCCGCATGGGGTTACTGGAGAAGC TTCCGTTGAATCCATTCCTTTTCAGGTATTAAGTTGGAAACCAAGAGCACTTTATTTTCCGAAGTTTGCGACTCCCGAACAATGCGAAAGCATAATCAAA ATGGTTGAGTCTAAATTAAAACCATCTACACTAGCTTTGCGAAAGGGAGAAACTGCTGAGAGTACCAAAGACACTAGAACAAGTTCAGGATCATTTGTTA GTGGATCAGAAGATGAAACTGGGACCTTGGACTTCATCGAGAAGAAAATTGCAAAGGCTACAATGATCCCGCAATCCCATGGAGAGGCATTTAATATCTT GCGTTATGAAATCGGGCAGAAGTATGATTCGCATTATGATGCGTTTAACCCAGACGAATATGGTCAACAGTCGAGCCAAAGGACTGCTTCTTTCTTGCTG TATCTGTCTAATGTGGAAGAAGGTGGAGAAACCATGTTCCCCTTCGAGAATGGCTCTGCAGTAATTCCTGGTTTTGATTACAAACAATGTGTTGGCTTGA AAGTGAAGCCTCGGCAAGGTGATGGGCTTCTATTTTACTCATTGTTTCCAAATGGCACAATTGATCCGACATCTCTTCACGGAAGCTGTCCAGTCATCAA AGGGGTGAAATGGGTGGCAACAAAGTGGATTAGAGATCAAATATGGACTAGGGATGAATAG
AA sequence Show only first row Show all	>Potri.009G091000.1 pacid=42770781 polypeptide=Potri.009G091000.1.p locus=Potri.009G091000 ID=Potri.009G091000.1.v4.1 annot-version=v4.1 MKIKTKRSKRKLGLPAAIILCSLFFLAGFYSSIFFPHDVPVTRPRLRMLEVAEGDHDTMPHGVTGEASVESIPFQVLSWKPRALYFPKFATPEQCESIIK MVESKLKPSTLALRKGETAESTKDTRTSSGSFVSGSEDETGTLDFIEKKIAKATMIPQSHGEAFNILRYEIGQKYDSHYDAFNPDEYGQQSSQRTASFLL YLSNVEEGGETMFPFENGSAVIPGFDYKQCVGLKVKPRQGDGLLFYSLFPNGTIDPTSLHGSCPVIKGVKWVATKWIRDQIWTRDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33910			2-oxoglutarate (2OG) and Fe(II...		Potri.009G091000 [exp]	0	1
AT1G22540			Major facilitator superfamily ...		Potri.013G106700 [exp]	8.77	0.7448
AT4G20990		ATACA4, ACA4	A. THALIANA ALPHA CARBONIC ANH...		Potri.016G043700 [exp]	9.32	0.7642
AT1G20160		ATSBT5.2	Subtilisin-like serine endopep...		Potri.005G243000 [exp]	10.00	0.7587	SSTP.3
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.019G014405 [exp]	13.19	0.7577
AT3G22740		HMT3	homocysteine S-methyltransfera...		Potri.008G155900 [exp]	23.55	0.7515	HMT3.1
AT1G23380	HD	KNAT6S, KNAT6L,...	KNOTTED1-like homeobox gene 6 ...		Potri.010G043500 [exp]	23.74	0.7545
AT3G57710			Protein kinase superfamily pro...		Potri.002G004900 [exp]	29.08	0.7173
AT4G29080	AUX_IAA	IAA27, PAP2	indole-3-acetic acid inducible...		Potri.003G051300 [exp]	30.49	0.7208	Pt-PAP2.3
					Potri.005G000033 [exp]	34.98	0.7307
AT5G46295			unknown protein		Potri.011G079900 [exp]	35.25	0.7311

Compare expression of checked genes

Potri.009G091000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.