Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19550 85 / 1e-22 unknown protein AT1G73120 42 / 5e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G296900 [exp] 158 / 1e-51 AT3G19550 83 / 7e-22 unknown protein Potri.010G248600 [exp] 44 / 1e-06 AT1G73120 102 / 3e-29 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002114 [exp] 79 / 6e-21 AT3G19550 77 / 2e-20 unknown protein Lus10002115 [exp] 79 / 6e-21 AT3G19550 77 / 2e-20 unknown protein Lus10013901 [exp] 78 / 9e-20 AT3G19550 79 / 4e-20 unknown protein Lus10013900 [exp] 59 / 3e-12 AT3G19550 50 / 6e-09 unknown protein Lus10022961 [exp] 40 / 3e-05 AT1G73120 64 / 2e-14 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [poplar] [flax] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.009G091100.3 pacid=42772777 polypeptide=Potri.009G091100.3.p locus=Potri.009G091100 ID=Potri.009G091100.3.v4.1 annot-version=v4.1 ATGATTTCAAAAACAAAGATGCTAATGCTTAGGTATGGCAGCTCGTGCAGGAAAACCAGGCCACCACTCCAGTGCCATTTTAGCAGTCCTCCATCAGTAT ACCAGCCAGAAAAATCGAGGAACTCGATCAAAGAAAGCAAGATGGAGGATTGGGCACCTCATCCTCGCACAGGGATTTATGTCCCAAAAGGCCACGAGAA GGTGATGGACGATGTACCAGAGAAAGCAGCTTCATTAAATCAGACTTATTGGCTAAGGAATGTTGATGGTGTTGAGAAACCAGACCCTGACACACCCCAT GATCCTTGCTTGTCTACCAATCTTTCTTGA
AA sequence Show only first row Show all	>Potri.009G091100.3 pacid=42772777 polypeptide=Potri.009G091100.3.p locus=Potri.009G091100 ID=Potri.009G091100.3.v4.1 annot-version=v4.1 MISKTKMLMLRYGSSCRKTRPPLQCHFSSPPSVYQPEKSRNSIKESKMEDWAPHPRTGIYVPKGHEKVMDDVPEKAASLNQTYWLRNVDGVEKPDPDTPH DPCLSTNLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19550			unknown protein		Potri.009G091100 [exp]	0	1
AT2G22420			Peroxidase superfamily protein...		Potri.007G096200 [exp]	12.00	0.8163
AT1G31880		BRX, NIP3;1, NL...	BREVIS RADIX, DZC (Disease res...		Potri.001G131800 [exp]	13.52	0.8506
AT3G19540			Protein of unknown function (D...		Potri.001G297500 [exp]	15.87	0.7924
AT1G75710	C2H2ZnF		C2H2-like zinc finger protein ...		Potri.005G173400 [exp]	15.87	0.8044
AT1G76990		ACR3	ACT domain repeat 3 (.1.2.3.4....		Potri.005G185600 [exp]	17.32	0.8004	Pt-ACR3.2
					Potri.005G053150 [exp]	18.65	0.7971
AT3G51290			Protein of unknown function (D...		Potri.007G056700 [exp]	20.97	0.8276
AT2G15830			unknown protein		Potri.009G107050 [exp]	22.27	0.7948
AT5G19930			Protein of unknown function DU...		Potri.018G073000 [exp]	27.27	0.7665
AT2G20830			transferases;folic acid bindin...		Potri.013G145600 [exp]	46.79	0.7572

Compare expression of checked genes

Potri.009G091100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.