Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14880 169 / 7e-55 SWIB/MDM2 domain superfamily protein (.1) AT4G34290 157 / 2e-50 SWIB/MDM2 domain superfamily protein (.1) AT3G03590 105 / 7e-30 SWIB/MDM2 domain superfamily protein (.1) AT2G35605 103 / 2e-29 SWIB/MDM2 domain superfamily protein (.1) AT1G31760 97 / 5e-27 SWIB/MDM2 domain superfamily protein (.1) AT4G26810 70 / 3e-16 SWIB/MDM2 domain superfamily protein (.1.2) AT4G22360 73 / 8e-16 SWIB complex BAF60b domain-containing protein (.1) AT1G49520 72 / 2e-15 SWIB complex BAF60b domain-containing protein (.1) AT3G19080 69 / 2e-14 SWIB complex BAF60b domain-containing protein (.1) AT3G48600 66 / 3e-14 SWIB complex BAF60b domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G297400 [exp] 223 / 2e-76 AT2G14880 142 / 3e-44 SWIB/MDM2 domain superfamily protein (.1) Potri.013G070600 [exp] 115 / 7e-34 AT2G35605 108 / 2e-31 SWIB/MDM2 domain superfamily protein (.1) Potri.015G137600 [exp] 70 / 2e-16 AT4G26810 181 / 1e-60 SWIB/MDM2 domain superfamily protein (.1.2) Potri.004G145200 [exp] 74 / 5e-16 AT1G49520 308 / 6e-103 SWIB complex BAF60b domain-containing protein (.1) Potri.009G106700 [exp] 73 / 7e-16 AT1G49520 301 / 5e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.005G134500 [exp] 71 / 4e-15 AT3G19080 226 / 3e-70 SWIB complex BAF60b domain-containing protein (.1) Potri.006G010700 [exp] 71 / 5e-15 AT4G22360 303 / 2e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.016G013400 [exp] 68 / 5e-14 AT4G22360 301 / 1e-99 SWIB complex BAF60b domain-containing protein (.1) Potri.007G039350 [exp] 50 / 2e-08 AT3G19080 118 / 4e-32 SWIB complex BAF60b domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013893 [exp] 176 / 9e-58 AT2G14880 143 / 7e-45 SWIB/MDM2 domain superfamily protein (.1) Lus10002106 [exp] 120 / 1e-36 AT4G34290 109 / 2e-32 SWIB/MDM2 domain superfamily protein (.1) Lus10005667 [exp] 104 / 2e-29 AT3G03590 118 / 4e-35 SWIB/MDM2 domain superfamily protein (.1) Lus10009333 [exp] 72 / 9e-16 AT3G19080 266 / 4e-87 SWIB complex BAF60b domain-containing protein (.1) Lus10019640 [exp] 72 / 2e-15 AT3G19080 256 / 2e-81 SWIB complex BAF60b domain-containing protein (.1) Lus10038799 [exp] 66 / 1e-13 AT4G26810 160 / 1e-50 SWIB/MDM2 domain superfamily protein (.1.2) Lus10016581 [exp] 66 / 2e-13 AT4G22360 190 / 1e-55 SWIB complex BAF60b domain-containing protein (.1) Lus10014892 [exp] 66 / 2e-13 AT4G22360 243 / 2e-76 SWIB complex BAF60b domain-containing protein (.1) Lus10013894 [exp] 66 / 4e-13 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10034774 [exp] 61 / 1e-12 AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02201 [poplar] [flax] SWIB SWIB/MDM2 domain
Representative CDS sequence Show only first row Show all	>Potri.009G092200.1 pacid=42772137 polypeptide=Potri.009G092200.1.p locus=Potri.009G092200 ID=Potri.009G092200.1.v4.1 annot-version=v4.1 ATGGCAATTTCTTCAGGGATTTTCTCTACTTTCCTATCCACCGAAACGGTGCCGCTTCTCAAGTTTCCTTCTCCTACATCCACTCTTCCTCTCAGGTTTC TGGCTGCGCCTCCCGCGAACCCGCGCATGGTGCGTAGTACTGTAGTTACCTGCGCCACGGCATCGACCGGAAACCGTGCTCCACGCGGCATAATGAAGCC GAGGCGAGTCTCACCTGAAATGGCGGACTTTATTGGTGCTCCTGAGGTCTCTCGTACTCAGGCTCTCAAGCTTATATGGGCCCATATCAAGGAGCACAAT CTTCAGGACCCTAGTAACAAGAAGAACATAATTTGTGACGAGAAGTTGAAGAAGATATTTGCTGGTAGAGACCAGGTTGGATTTCTTGAGATTGCTGGGT TGATTAGTCCTCATTTCCTCAAATGA
AA sequence Show only first row Show all	>Potri.009G092200.1 pacid=42772137 polypeptide=Potri.009G092200.1.p locus=Potri.009G092200 ID=Potri.009G092200.1.v4.1 annot-version=v4.1 MAISSGIFSTFLSTETVPLLKFPSPTSTLPLRFLAAPPANPRMVRSTVVTCATASTGNRAPRGIMKPRRVSPEMADFIGAPEVSRTQALKLIWAHIKEHN LQDPSNKKNIICDEKLKKIFAGRDQVGFLEIAGLISPHFLK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14880			SWIB/MDM2 domain superfamily p...		Potri.009G092200 [exp]	0	1
AT2G21170		PDTPI, TIM	PLASTID ISOFORM TRIOSE PHOSPHA...		Potri.009G129500 [exp]	2.00	0.8271	TIM.2
AT3G10940		LSF2	LIKE SEX4 2, dual specificity ...		Potri.019G048600 [exp]	2.44	0.8166
AT3G47590			alpha/beta-Hydrolases superfam...		Potri.018G068000 [exp]	2.44	0.8338
AT3G07330		ATCSLC6, ATCSLC...	CELLULOSE-SYNTHASE LIKE C6, Ce...		Potri.014G190900 [exp]	2.64	0.8644
AT1G05810		ARA, Ara-1, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.002G249500 [exp]	3.16	0.8063	RAB11.3
AT3G06470			GNS1/SUR4 membrane protein fam...		Potri.003G019700 [exp]	4.89	0.7980
AT2G37020			Translin family protein (.1.2)		Potri.006G126200 [exp]	6.48	0.7951
AT1G14720		ATXTH28, EXGT-A...	xyloglucan endotransglycosylas...		Potri.008G138400 [exp]	6.63	0.7535	EXGT.4
AT3G51780		ATBAG4	BCL-2-associated athanogene 4 ...		Potri.016G121200 [exp]	7.07	0.7496
AT5G37360			unknown protein		Potri.013G050300 [exp]	9.74	0.8234

Compare expression of checked genes

Potri.009G092200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.