Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) AT5G59845 92 / 7e-26 Gibberellin-regulated family protein (.1) AT2G39540 85 / 2e-23 Gibberellin-regulated family protein (.1) AT1G10588 80 / 4e-21 Gibberellin-regulated family protein (.1.2) AT1G74670 65 / 5e-15 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 56 / 5e-12 GASA4 GAST1 protein homolog 4 (.1.2) AT4G09600 55 / 2e-11 GASA3 GAST1 protein homolog 3 (.1) AT2G30810 52 / 3e-10 Gibberellin-regulated family protein (.1) AT1G22690 52 / 5e-10 Gibberellin-regulated family protein (.1.2.3) AT5G14920 53 / 1e-09 Gibberellin-regulated family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G297700 [exp] 137 / 7e-44 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.014G020100 [exp] 115 / 3e-35 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.001G315500 [exp] 71 / 1e-17 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.007G051300 [exp] 69 / 6e-17 AT2G14900 61 / 3e-13 Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 66 / 2e-15 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 62 / 6e-14 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 60 / 2e-13 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.013G113400 [exp] 59 / 8e-13 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 57 / 4e-12 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024791 [exp] 101 / 1e-29 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1) Lus10018708 [exp] 100 / 2e-29 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1) Lus10001407 [exp] 93 / 3e-26 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1) Lus10029340 [exp] 67 / 5e-16 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10030680 [exp] 62 / 7e-14 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10002059 [exp] 61 / 2e-13 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 61 / 3e-13 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10008612 [exp] 60 / 3e-13 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042012 [exp] 60 / 4e-13 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10004048 [exp] 60 / 4e-13 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [poplar] [flax] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Potri.009G092600.1 pacid=42771653 polypeptide=Potri.009G092600.1.p locus=Potri.009G092600 ID=Potri.009G092600.1.v4.1 annot-version=v4.1 ATGAAGAAGCTCTTCTTTGCTACTTTGCTGTTGTGTTCACTCCTCTTCAGCTCGTCTTTCTTGGAACCTGTCATGGCTAAGTCATCTTTCTGTGCCAAGA AGTGCGAAACGAGGTGCGCAAACGCTGGCATACAGGATAGGTGCTTGAAGTACTGTGGAATATGCTGCGAACAGTGCAAGTGTGTGCCCTCTGGAACTTA TGGGAACAAGCATGAGTGCCCTTGTTACAGGGACAAGAGGAACTCCAAGGGCAAGCCCAAGTGTCCTTAA
AA sequence Show only first row Show all	>Potri.009G092600.1 pacid=42771653 polypeptide=Potri.009G092600.1.p locus=Potri.009G092600 ID=Potri.009G092600.1.v4.1 annot-version=v4.1 MKKLFFATLLLCSLLFSSSFLEPVMAKSSFCAKKCETRCANAGIQDRCLKYCGICCEQCKCVPSGTYGNKHECPCYRDKRNSKGKPKCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14900			Gibberellin-regulated family p...		Potri.009G092600 [exp]	0	1
AT3G63440		ATCKX6, CKX6, A...	CYTOKININ OXIDASE 6, cytokinin...		Potri.003G203600 [exp]	1.00	0.8570
AT2G31500		CPK24	calcium-dependent protein kina...		Potri.007G127000 [exp]	10.24	0.7479
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Potri.005G054000 [exp]	22.58	0.7893
AT2G23090			Uncharacterised protein family...		Potri.009G090800 [exp]	57.96	0.7524
AT1G71910			unknown protein		Potri.013G114000 [exp]	66.79	0.7245
AT5G52600	MYB	AtMYB82	myb domain protein 82 (.1)		Potri.006G066400 [exp]	121.70	0.7056
AT5G64460			Phosphoglycerate mutase family...		Potri.002G108600 [exp]	123.00	0.7266	PGM.1
AT5G42180		PER64	peroxidase 64, Peroxidase supe...		Potri.005G108900 [exp]	128.06	0.6875
					Potri.015G137350 [exp]	153.22	0.7260
AT2G22850	bZIP	ATBZIP6	basic leucine-zipper 6 (.1.2)		Potri.007G006900 [exp]	183.64	0.7075

Compare expression of checked genes

Potri.009G092600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.