Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15000 73 / 4e-18 unknown protein AT4G34265 61 / 2e-13 unknown protein AT4G17310 41 / 1e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G298800 [exp] 97 / 2e-27 AT2G15000 78 / 4e-20 unknown protein Potri.017G068600 [exp] 38 / 0.0001 AT4G17310 94 / 2e-26 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025365 [exp] 83 / 4e-22 AT2G15000 126 / 2e-39 unknown protein Lus10026596 [exp] 82 / 1e-21 AT2G15000 123 / 6e-38 unknown protein Lus10020971 [exp] 81 / 3e-21 AT2G15000 121 / 4e-37 unknown protein Lus10013885 [exp] 70 / 2e-16 AT2G15000 82 / 6e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G093400.3 pacid=42772435 polypeptide=Potri.009G093400.3.p locus=Potri.009G093400 ID=Potri.009G093400.3.v4.1 annot-version=v4.1 ATGGCTTGGCGCAGTGGAGGATCACTCTCGCGTTCGCTCATGTCCGCCGCCAGGGCGCCGCTTCCTCGCTCTTCTGCACCTCTCCCCCGCCTCCGTCCCC CGTCTTCCTCCGCACCCCGTTTACAATCTCGCCGCTTATCCTTTGCTCCTTCCAGGAACTTGGGAGAACTGGGATGCATGCAGTCGTTCTTGCCTTTGGT GTCCGCGGGGAACTTGACATCGCGTCTCAATGCTAATTTGCGGGCTTTTTGTGAGCTGTCTCATGGTACCTTCTGTCGTTCTTGTCCAGATCGCTAA
AA sequence Show only first row Show all	>Potri.009G093400.3 pacid=42772435 polypeptide=Potri.009G093400.3.p locus=Potri.009G093400 ID=Potri.009G093400.3.v4.1 annot-version=v4.1 MAWRSGGSLSRSLMSAARAPLPRSSAPLPRLRPPSSSAPRLQSRRLSFAPSRNLGELGCMQSFLPLVSAGNLTSRLNANLRAFCELSHGTFCRSCPDR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G15000			unknown protein		Potri.009G093400 [exp]	0	1
AT5G39600			unknown protein		Potri.004G228566 [exp]	1.73	0.8725
AT3G06040			Ribosomal protein L12/ ATP-dep...		Potri.015G077200 [exp]	2.00	0.8650
AT4G26780		MGE2, AR192	mitochondrial GrpE 2, Co-chape...		Potri.011G089000 [exp]	2.23	0.8595
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Potri.001G319900 [exp]	3.46	0.8375
AT1G15870			Mitochondrial glycoprotein fam...		Potri.001G047600 [exp]	3.46	0.8672
AT3G10950			Zinc-binding ribosomal protein...		Potri.003G085100 [exp]	3.46	0.8502
AT1G10865			unknown protein		Potri.010G248800 [exp]	5.47	0.8134
					Potri.001G340100 [exp]	5.91	0.8501
AT5G64650			Ribosomal protein L17 family p...		Potri.005G061700 [exp]	6.78	0.8203
AT4G25315			Expressed protein (.1.2)		Potri.004G189300 [exp]	7.41	0.8443

Compare expression of checked genes

Potri.009G093400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.