Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19508 128 / 9e-41 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G299200 [exp] 161 / 1e-53 AT3G19508 129 / 6e-41 unknown protein Potri.011G159100 [exp] 38 / 0.0002 AT5G44400 614 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G159200 [exp] 38 / 0.0002 AT5G44400 616 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G160400 [exp] 38 / 0.0002 AT5G44400 616 / 0.0 FAD-binding Berberine family protein (.1) Potri.001G463400 [exp] 36 / 0.001 AT1G30760 661 / 0.0 FAD-binding Berberine family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013875 [exp] 124 / 4e-39 AT3G19508 132 / 3e-42 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [poplar] [flax] LYR-like PF05347 [poplar] [flax] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Potri.009G094200.2 pacid=42771602 polypeptide=Potri.009G094200.2.p locus=Potri.009G094200 ID=Potri.009G094200.2.v4.1 annot-version=v4.1 ATGCAGAAAGCATTGGGAGTCTATGGACAGGTTCTGCGACTAGTGAGGCGGTTACCAAAGGACTCGAGGCCTTATTACGCCAAATACGCACGCGAAAACT TCGTCAACTACAGAGATGTCGAGGCCAATGACACCCAATTCCTCGACGAGCTCTTCCTTAGAGCATATAACCACTCCCTATGGGTTCTCAACAAGTATTC GGTTGATGAATCGGCTGCTACTAAACTGAAGGAGATTTGTTGCGGCTAG
AA sequence Show only first row Show all	>Potri.009G094200.2 pacid=42771602 polypeptide=Potri.009G094200.2.p locus=Potri.009G094200 ID=Potri.009G094200.2.v4.1 annot-version=v4.1 MQKALGVYGQVLRLVRRLPKDSRPYYAKYARENFVNYRDVEANDTQFLDELFLRAYNHSLWVLNKYSVDESAATKLKEICCG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19508			unknown protein		Potri.009G094200 [exp]	0	1
AT5G35530			Ribosomal protein S3 family pr...		Potri.012G076800 [exp]	1.41	0.8613
AT4G26400			RING/U-box superfamily protein...		Potri.017G038300 [exp]	5.47	0.8142
AT1G71990		ATFT4, ATFUT13,...	ARABIDOPSIS FUCOSYLTRANSFERASE...		Potri.013G111200 [exp]	6.24	0.7782	Pt-FUT1.2
AT2G39500			unknown protein		Potri.008G051100 [exp]	7.61	0.7476
AT5G16060			Cytochrome c oxidase biogenesi...		Potri.017G113401 [exp]	9.79	0.7979
AT4G35490		MRPL11	mitochondrial ribosomal protei...		Potri.007G058600 [exp]	10.24	0.8043
AT3G62840			Small nuclear ribonucleoprotei...		Potri.014G129100 [exp]	10.81	0.8319
AT4G25315			Expressed protein (.1.2)		Potri.004G189300 [exp]	11.40	0.7894
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Potri.016G006300 [exp]	11.53	0.7625
AT4G12600			Ribosomal protein L7Ae/L30e/S1...		Potri.019G087100 [exp]	14.56	0.8242

Compare expression of checked genes

Potri.009G094200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.