Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23210 54 / 2e-09 UDP-Glycosyltransferase superfamily protein (.1) AT4G15480 52 / 1e-08 UGT84A1 UDP-Glycosyltransferase superfamily protein (.1) AT3G21560 49 / 7e-08 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1) AT1G24100 49 / 8e-08 UGT74B1 UDP-glucosyl transferase 74B1 (.1) AT4G15490 49 / 8e-08 UGT84A3 UDP-Glycosyltransferase superfamily protein (.1) AT2G23260 49 / 1e-07 UGT84B1 UDP-glucosyl transferase 84B1 (.1) AT1G22360 48 / 2e-07 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22340 48 / 2e-07 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT2G23250 48 / 2e-07 UGT84B2 UDP-glucosyl transferase 84B2 (.1) AT1G22380 48 / 2e-07 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G095200 [exp] 111 / 4e-30 AT2G23260 413 / 5e-141 UDP-glucosyl transferase 84B1 (.1) Potri.009G095500 [exp] 108 / 4e-29 AT2G23260 421 / 2e-144 UDP-glucosyl transferase 84B1 (.1) Potri.007G049600 [exp] 65 / 2e-13 AT2G23260 422 / 1e-144 UDP-glucosyl transferase 84B1 (.1) Potri.017G051900 [exp] 48 / 1e-08 AT1G78270 92 / 8e-24 UDP-glucosyl transferase 85A4 (.1) Potri.001G312600 [exp] 50 / 2e-08 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.009G095400 [exp] 50 / 3e-08 AT4G15480 488 / 2e-169 UDP-Glycosyltransferase superfamily protein (.1) Potri.009G095100 [exp] 50 / 3e-08 AT4G15480 496 / 3e-173 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G052500 [exp] 50 / 4e-08 AT4G15550 419 / 3e-143 indole-3-acetate beta-D-glucosyltransferase (.1) Potri.007G140700 [exp] 50 / 4e-08 AT1G05680 357 / 2e-120 Uridine diphosphate glycosyltransferase 74E2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021163 [exp] 54 / 3e-09 AT3G02100 192 / 7e-57 UDP-Glycosyltransferase superfamily protein (.1) Lus10024583 [exp] 53 / 5e-09 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10024584 [exp] 51 / 1e-08 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032220 [exp] 50 / 3e-08 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10040533 [exp] 50 / 3e-08 AT3G02100 256 / 1e-80 UDP-Glycosyltransferase superfamily protein (.1) Lus10027862 [exp] 50 / 3e-08 AT4G15480 414 / 3e-141 UDP-Glycosyltransferase superfamily protein (.1) Lus10020559 [exp] 50 / 4e-08 AT2G43820 436 / 3e-150 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10032218 [exp] 50 / 4e-08 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10013923 [exp] 50 / 5e-08 AT1G22400 537 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013924 [exp] 49 / 9e-08 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G095550.1 pacid=42772652 polypeptide=Potri.009G095550.1.p locus=Potri.009G095550 ID=Potri.009G095550.1.v4.1 annot-version=v4.1 ATGGAAATCTTGAAGGAAAACAAAGAAGAAGAAATTCATGTGCTAATGGTGGCACTCTCATCTCAGGGTCACTTAAACCCCATGGTTAGACTAGGTAAAC GCTTGGTCAATAAAGGTCTCCATGTCACACTGGCCACCACTGAATTCACCCGTCACCGCATGCTCAAATCTTCCACCATCAACCCCACCTCCTCCACCAT CTCAATCTCTGGAGTCCAGACTGCTGAGATCGCTTTCTGTCCGCCGAGAGTTTGGGACCAGCTTTCTGGGTGGTTTTCCCTTGATGGGCTGCTTTTTTTT TTTTTTTTGGTGTGGAATAAAAAGGGCAATACTTAG
AA sequence Show only first row Show all	>Potri.009G095550.1 pacid=42772652 polypeptide=Potri.009G095550.1.p locus=Potri.009G095550 ID=Potri.009G095550.1.v4.1 annot-version=v4.1 MEILKENKEEEIHVLMVALSSQGHLNPMVRLGKRLVNKGLHVTLATTEFTRHRMLKSSTINPTSSTISISGVQTAEIAFCPPRVWDQLSGWFSLDGLLFF FFLVWNKKGNT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G23210			UDP-Glycosyltransferase superf...		Potri.009G095550 [exp]	0	1
					Potri.005G163950 [exp]	2.23	0.8754
					Potri.008G103700 [exp]	2.82	0.9185
AT1G55230			Family of unknown function (DU...		Potri.003G216500 [exp]	3.87	0.8889
AT3G29320		PHS1	alpha-glucan phosphorylase 1, ...		Potri.004G123600 [exp]	4.35	0.8148	PHO1.2
AT4G35900	bZIP	ATBZIP14, FD-1,...	Basic-leucine zipper (bZIP) tr...		Potri.005G109500 [exp]	4.58	0.8653
AT5G47510			Sec14p-like phosphatidylinosit...		Potri.001G158700 [exp]	6.00	0.8193
AT2G23260		UGT84B1	UDP-glucosyl transferase 84B1 ...		Potri.009G095200 [exp]	7.74	0.8134
					Potri.010G147200 [exp]	7.74	0.8691
AT2G01080			Late embryogenesis abundant (L...		Potri.001G208000 [exp]	8.00	0.8265
					Potri.006G120650 [exp]	8.06	0.8396

Compare expression of checked genes

Potri.009G095550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.